All Starred Repos

4,870 repos
A polyglot document intelligence framework with a Rust core. Extract text, metadata, images, and structured information from PDFs, Office documents, images, and 97+ formats. Available for Rust, Python, Ruby, Java, Go, PHP, Elixir, C#, R, C, TypeScript (Node/Bun/Wasm/Deno)- or use via CLI, REST API, or MCP server.
★ 8,133Rustupdated 2026-04-29buncsharpdocument-intelligenceelixirffi
Vapi MCP Server
★ 47TypeScriptupdated 2026-03-23aimcpmcp-servervapivoice-agents
Claude Code Changelog Tracker with AI analysis, TTS, and email notifications
★ 21TypeScriptupdated 2026-01-09
Tracking prompts, feature flags and metadata of Claude Code releases. Subscribe to ↓
★ 793updated 2026-04-29ai-agentsanthropicanthropic-claudeclaude-codeclaude-code-system-prompts
[AAAI 2024] Official pytorch implementation of “Learning Real-World Image De-Weathering with Imperfect Supervision”
★ 17Pythonupdated 2024-08-22
Jupyter notebooks and Python code for analyzing air quality (fine particle, PM2.5)
★ 44HTMLupdated 2021-08-15air-qualityairnowanalysiscorrelationpandas
An awesome list of air quality resources.
★ 70updated 2025-06-02air-qualityaqiawesome-listcode4cleanair
🧭 Open source tools for air quality data analysis
★ 352Rupdated 2026-04-27air-qualityair-quality-datameteorologyopenairpackage
★ 1Pythonupdated 2026-04-23
This repository contains a collection of custom scripts for Sentinel Hub on Copernicus Data Space Ecosystem.
★ 5JavaScriptupdated 2026-04-24
Real-time natural events dashboard — USGS + NASA EONET + NASA FIRMS + Sentinel-2 NBR analysis.
★ 1Pythonupdated 2026-04-25fastapigeospatialhubimageryleaflet
Monitor and study any place on Earth and in Near Real-Time using the Sentinel Hub services developed by the EO research team at Sinergise
★ 71Pythonupdated 2026-04-27earth-observationpythonsatellitesentinel-hub
Download and process satellite imagery in JavaScript or TypeScript using Sentinel Hub services.
★ 57TypeScriptupdated 2026-04-13sentinelsentinel-1sentinel-2sentinel-3sentinel-5p
QGIS Plugin for Sentinel Hub
★ 43Pythonupdated 2026-03-18
Sentinel Hub Cloud Detector for Sentinel-2 images in Python
★ 486Pythonupdated 2026-01-15classificationcloud-detectorpython-librarysentinel-2sentinel-hub
:link: Methods for Correlation Analysis
★ 451Rupdated 2026-04-01bayesianbayesian-correlationsbiserialcorcorrelation
🎚️ Open Source Audio Matching and Mastering
★ 2,500Pythonupdated 2026-04-19audiodocker-imagedspequalizerfilter
Removes silence segments from wav audio files
★ 30Pythonupdated 2020-02-29
OpenShot Audio Library (libopenshot-audio) is a free, open-source project that enables high-quality editing and playback of audio, and is based on the amazing JUCE library.
★ 289C++updated 2026-03-20audioaudio-effectsaudio-libraryaudio-processingc-plus-plus
A powerful 3B-parameter, LLM-based Reinforcement Learning audio edit model excels at editing emotion, speaking style, and paralinguistics, and features robust zero-shot text-to-speech
★ 913Pythonupdated 2026-04-09audio-editingcross-lingualemotion-controlparalinguisticsreinforcement-learning
A library for audio and music analysis, feature extraction.
★ 3,302Cupdated 2026-03-06audioaudio-analysisaudio-featuresaudio-processingdeep-learning
🎤⌨️ Acoustic keyboard eavesdropping
★ 8,998C++updated 2023-01-15acousticeavesdropmicrophone-audio-capture
Audio Editor
★ 16,885C++updated 2026-04-28audiocross-platformeditorgplv2wxwidgets-applications
Teensy Audio Library
★ 1,233C++updated 2026-04-26
AssemblyAI's Official Python SDK
★ 205Pythonupdated 2026-04-28
Show Hebrew date in gnome-shell panel
★ 11JavaScriptupdated 2026-04-21gnome-shellgnome-shell-extension
Simple editor for adding nekudot and te'amim to Hebrew text
★ 1TypeScriptupdated 2026-04-20
International Public Radio Directory, bringing diversity into audio. Public listing of internet radios from all around the world.
★ 18Pythonupdated 2026-04-27
Claude Code skill that removes signs of AI-generated writing from text
★ 16,319updated 2026-04-01
The Free Software Media System - Server Backend & API
★ 50,847C#updated 2026-04-27csharpdotnethacktoberfestjellyfin
A curated list of awesome disfluency detection publications along with the released code and bibliographical information
★ 83updated 2021-05-02awesome-listconversational-speech-recognitionconversational-speech-translationdeep-disfluency-codedeep-disfluency-detection
Termux add-on app for integration with Tasker.
★ 1,478Javaupdated 2026-02-27androidtermux
Adds right-to-left (RTL) text support to Claude Code for Hebrew, Arabic and more
★ 1JavaScriptupdated 2026-04-23
is a professional-grade translation engine designed to bridge the gap between English and Hebrew with surgical precision. Unlike standard translators, Aegis employs a multi-layered "Shield" architecture featuring automated auditing and AI-driven quality assurance to ensure every line is natural, accurate, and perfectly formatted.
★ 1Pythonupdated 2026-04-27aideepseek-apigemini-apihebrewhebrew-english
Bridge font adding Hebrew coverage to JetBrains Mono — addresses JetBrainsMono#119
★ 1Pythonupdated 2026-04-22
Hebrew handwriting font for free use
★ 12updated 2025-11-14
open source licensed, unciode fonts in Hebrew, Latin, Greek, Cyrillic, and Amharic scripts
★ 11updated 2018-10-05
Mobile Shell
★ 13,832C++updated 2026-03-22
Browser Harness | Self-healing harness that enables LLMs to complete any task.
★ 8,048Pythonupdated 2026-04-26
A cross-platform, OpenGL terminal emulator.
★ 63,726Rustupdated 2026-04-14bsdgpulinuxmacosopengl
The BEST music separation model with help of A.I. ... to my ears ! 👂👂
★ 149Pythonupdated 2024-06-10artificial-intelligenceaudioinstrumentalinstrumentalskaraoke
Will be the best karaoke system.
★ 235C#updated 2026-04-18andy840119karaokekaraoke-applicationkaraoke-lyrics-editorkaraoke-maker
Generate lyric-aligned SRT subtitles with Gemini and review them in a local viewer.
★ 3JavaScriptupdated 2026-04-12geminilocal-firstlyricsplaywrightpython
Generate karaoke videos, by downloading audio and lyrics, separating instrumentals, synchronising lyrics using transcription models, rendering CDG and uploading videos to YouTube / Dropbox / Google Drive
★ 128HTMLupdated 2026-04-27karaokekaraoke-makerlyricsmusicvideo
🎥 Make videos programmatically with React
★ 45,095TypeScriptupdated 2026-04-27javascriptreactvideo
Video.js - open source HTML5 video player
★ 39,713JavaScriptupdated 2026-03-11dashhlshtmlhtml5html5-audio
Streamlink is a CLI utility which pipes video streams from various services into a video player
★ 11,433Pythonupdated 2026-04-26clilivestreampythonstreamingstreaming-services
Compare and generate AI videos across Sora, Veo, Kling, Seedance & more.
★ 30TypeScriptupdated 2026-04-26ai-toolsai-video-generationai-video-generatorfal-aigenerative-ai
AI video generation SDK — JSX for videos. One API for Kling, Flux, ElevenLabs, Sora. Built on Vercel AI SDK.
★ 284TypeScriptupdated 2026-04-27ai-sdkai-videoclaude-codecursorelevenlabs
WaveSpeedAI Python Client — Official Python SDK for WaveSpeedAI inference platform. This library provides a clean, unified, and high-performance API and serverless integration layer for your applications. Effortlessly connect to all WaveSpeedAI models and inference services with zero infrastructure overhead.
★ 19Pythonupdated 2026-02-03
A cross-platform desktop application for running AI models from [WaveSpeedAI](https://wavespeed.ai), as well as many free local AI models including Z-Image.
★ 147TypeScriptupdated 2026-04-24aiai-image-generationai-image-generatorimagevideo
https://wavespeed.ai/ [WIP] The all in one inference optimization solution for ComfyUI, universal, flexible, and fast.
★ 1,227Pythonupdated 2025-08-02
Claude Code Skills for podcast/video editing: transcription, content editing, rough/fine cut, final polish
★ 30HTMLupdated 2026-03-17
CLI client for podwise.ai — turn any podcast episode into AI-powered insights, designed for use in AI agents and skills workflows.
★ 226Goupdated 2026-04-04
AI-powered image generation using Google Gemini, integrated with Claude Code via Skills or Claude.ai via MCP (Model Context Protocol).
★ 34JavaScriptupdated 2026-03-15claudeclaude-codeclaude-extensionsclaude-pluginsclaude-skills
JoyAI-Image is the unified multimodal foundation model for image understanding, text-to-image generation, and instruction-guided image editing.
★ 1,963Pythonupdated 2026-04-15
🖼️ Image Toolbox is a powerful app for advanced image manipulation. It offers dozens of features, from basic tools like crop and draw to filters, OCR, and a wide range of image processing options
★ 12,687Kotlinupdated 2026-04-26aiandroidbackground-removalcropedit-photo
alibaba cloud skills,qwen ,wan and all skills
★ 383Pythonupdated 2026-04-08
Deterministic video editing SDK for AI agents. Ships with MCP tools.
★ 5TypeScriptupdated 2026-03-15ai-agentclaudeeditingffmpegmcp
AI-powered video editor that turns raw footage and a creative brief into a polished ad using an ensemble of AI agents (Google Gemini + FFmpeg)
★ 387Pythonupdated 2026-04-14
AI-powered video editor with FFMPEG, Remotion, & Obsidian Agents Baked in
★ 126TypeScriptupdated 2026-04-15
AI-powered video podcast creation skill for coding agents. Supports Bilibili & YouTube, multi-language (zh-CN/en-US), 6 TTS engines (Edge/Azure/ElevenLabs/OpenAI/Doubao/CosyVoice), 4K Remotion rendering.
★ 647Pythonupdated 2026-04-27agent-skillsai-videobilibiliclaude-codeclaude-code-skill
World's first open-source, agentic video production system. 12 pipelines, 52 tools, 500+ agent skills. Turn your AI coding assistant into a full video production studio.
★ 3,247Pythonupdated 2026-04-24agentagentic-aiaiclaudecopilot
Agent-native image-editing SDK for Claude Code. 21 MCP tools + /decompose skill — semantic layer splits, L1–L5 cultural scoring, region inpaint. Powered by ComfyUI, Gemini, or mock.
★ 8Pythonupdated 2026-04-26agent-nativeaianthropicartclaude-code
LTX-2.3 video generation skill — setup, inference, prompting, ComfyUI integration for Lightricks 22B DiT audio-video model
★ 4Pythonupdated 2026-03-27
A full-featured image/video management app with AI-powered organization and semantic search. Supports metadata from SD-webui, ComfyUI, Fooocus, NovelAI, StableSwarmUI, and more. Available as standalone app, SD-webui extension, or library.
★ 1,291Vueupdated 2026-04-08audiocomfyuiextensionfile-explorerfile-server
Natural language → ComfyUI workflow JSON. 34 built-in templates, 360+ node definitions, auto model download. Supports txt2img, img2img, txt2vid, img2vid, audio, 3D generation across SD1.5/SDXL/SD3/FLUX/Wan2.2/HunyuanVideo/LTXV/Mochi/Cosmos + LLM integration. Works as a skill for Claude Code, Cursor, and other AI coding agents.
★ 190updated 2026-04-09
Interactive domain name brainstorming tool for Claude Code. Describe your business idea, get brandable domain suggestions, and check .com availability via Namecheap API.
★ 3JavaScriptupdated 2026-03-07ai-toolsbrandable-domainsclaude-codecli-tooldomain-availability
Get your free '{name}.thedev.me' domain
★ 131JavaScriptupdated 2026-04-26dnsfreefree-domainfree-domainsfree-for-dev
Fast, universal domain availability checker - 1,200+ TLDs, pattern generation, RDAP with WHOIS fallback. CLI + Rust library + MCP server for AI agents.
★ 267Rustupdated 2026-03-22asynccliconcurrencydomain-checkdomain-check-lib
Domain Availability Research Tool
★ 1,814Goupdated 2026-04-10clideveloper-toolsdomaingolang
Circadian Lighting custom component for Home Assistant
★ 881Pythonupdated 2025-09-19circadiancircadian-rhythmshacshome-assistantlighting
Auto-Manage Your Personal Task Context with AI.
★ 2,141TypeScriptupdated 2026-04-14agentic-aicontext-engineeringlifelogtodolist
The Context Optimization Layer for LLM Applications
★ 1,593Pythonupdated 2026-04-26agentaianthropiccompressioncontext-engineering
The context development platform. Store, enrich, and retrieve structured knowledge with graph-native infrastructure, semantic retrieval, and portable context cores.
★ 2,029Pythonupdated 2026-04-24agentagent-memoryai-infraai-toolscontext
Lossless Claw — LCM (Lossless Context Management) plugin for OpenClaw
★ 4,483TypeScriptupdated 2026-04-23
A Git-native, AI-optimized documentation system that turns your repo into a living knowledge base.
★ 241TypeScriptupdated 2026-04-21
Context-Engine MCP - Agentic Context Compression Suite
★ 387Svelteupdated 2026-04-25aiai-agentscodexcompressioncontext
Hand-crafted Claude Code Skills focused on improving agent results quality. Compatible with OpenCode, Cursor, Antigravity, Gemini CLI, and others.
★ 886TypeScriptupdated 2026-04-22agentaiclaudeclinecursor
Awesome resources for in-context learning and prompt engineering: Mastery of the LLMs such as ChatGPT, GPT-3, and FlanT5, with up-to-date and cutting-edge updates.
★ 2,228Jupyter Notebookupdated 2026-04-02ai-agentchain-of-thoughtchatbotchatgptchatgpt-api
Semantic Intelligence for Large-Scale Engineering. Context+ is an MCP server designed for developers who demand 99% accuracy. By combining RAG, Tree-sitter AST, Spectral Clustering, and Obsidian-style linking, Context+ turns a massive codebase into a searchable, hierarchical feature graph.
★ 1,776TypeScriptupdated 2026-04-06mcp-server
🧠 Make your agents learn from experience. Now available as a hosted solution at kayba.ai
★ 2,176Pythonupdated 2026-04-25agent-learningagent-memoryagentsaiai-agents
A comprehensive collection of Agent Skills for context engineering, multi-agent architectures, and production agent systems. Use when building, optimizing, or debugging agent systems that require effective context management.
★ 15,339Pythonupdated 2026-04-14
★ 13,098JavaScriptupdated 2026-04-25
X/Twitter research skill for Claude Code and OpenClaw. Agentic search, thread following, deep-dives, sourced briefings.
★ 1,098TypeScriptupdated 2026-02-19
Structured deep research skill for Claude Code/Open Code/Codex with human-in-the-loop control
★ 569Pythonupdated 2026-04-10claude-codeclaude-code-skillsdeep-research-agentgpt-skillsllm-agent
💡 A Home Assistant card for RGB lights
★ 557JavaScriptupdated 2025-12-04home-assistantlovelacelovelace-custom-cardrgb-lights
A format specification for describing a visual identity to coding agents. DESIGN.md gives agents a persistent, structured understanding of a design system.
★ 9,912TypeScriptupdated 2026-04-22
Download market data from Yahoo! Finance's API
★ 23,263Pythonupdated 2026-04-25financial-datafix-yahoo-financemarket-datapandaspython
A collection of AI-native operating systems powered by Claude Code. Manage work, career, life, and meetings through conversation.
★ 11Shellupdated 2026-03-03agentic-osai-agentsai-nativeanthropiccareer-tools
An awesome list that curates the best QGis frameworks, libraries, tools, plugins, tutorials, articles,resources and more.
★ 26updated 2026-04-06awesomeawesome-listqgisqgis-plugin
QGIS plugin to export your project to an OpenLayers or Leaflet webmap. No server-side software required.
★ 691JavaScriptupdated 2026-04-07csshtmljavascriptleafletleafletjs
A simplified touch optimized interface for QGIS
★ 1,185C++updated 2026-04-25androidgisioslinuxmacos
A framework for evaluating models on their alignment to brain and behavioral measurements (100+ benchmarks)
★ 185Pythonupdated 2026-04-24
OmniEvalKit is an evaluation framework designed for omni-modal large language models, with a focus on audio and audio-visual understanding. Based on OmniEvalKit, you can quickly reproduce benchmarks, implement your own models or datasets, and conduct fair comparisons with other open-source models. MiniCPM-o is evaluated using this framework.
★ 7Pythonupdated 2026-03-27
A reproducible evaluation of how frontier LLMs handle grounded vs. ungrounded questions in RAG systems — measuring correctness, grounding, and calibrated refusal.
★ 2Pythonupdated 2026-04-24ai-safetyanthropicbenchmarkevaluationgemini
MiroEval: A benchmark and evaluation framework for deep research agents — 100 tasks (70 text, 30 multimodal) assessed across synthesis quality, factuality, and research process. 13 systems evaluated.
★ 39Pythonupdated 2026-04-06
Official repository for the paper “MME-Emotion: A Holistic Evaluation Benchmark for Emotional Intelligence in Multimodal Large Language Models”
★ 38Pythonupdated 2026-01-17
[ICML 2024] | MMT-Bench: A Comprehensive Multimodal Benchmark for Evaluating Large Vision-Language Models Towards Multitask AGI
★ 120Pythonupdated 2026-04-06
A Unified Benchmark and Toolbox for Multimodal Jailbreak Attack–Defense Evaluation
★ 68Pythonupdated 2026-03-02
MultimodalHugs is an extension of Hugging Face that offers a generalized framework for training, evaluating, and using multimodal AI models with minimal code differences, ensuring seamless compatibility with Hugging Face pipelines.
★ 17Pythonupdated 2026-04-17huggingfacehuggingface-transformersmultimodalmultimodal-deep-learningmultimodal-large-language-models
GameWorld: Towards Standardized and Verifiable Evaluation of Multimodal Game Agents
★ 162Pythonupdated 2026-04-24agentbenchmarkcomputer-usegamegui
EmoBench-M: A benchmark for evaluating Emotional Intelligence in Multimodal Large Language Models.
★ 138Pythonupdated 2026-04-01benchmarkemobenchemotionemotional-intelligence
Holistic Evaluation of Multimodal LLMs on Spatial Intelligence
★ 107Pythonupdated 2026-04-24mllmmllm-evaluationmultimodal-modelsspatial-intelligence
A Flexible Framework for Comprehensive Multimodal Model Evaluation
★ 103Pythonupdated 2026-04-21
MedEvalKit: A Unified Medical Evaluation Framework
★ 227Pythonupdated 2026-02-24evaluation-frameworkllmmedicalaimultimodal
The RAG Experiment Accelerator is a versatile tool designed to expedite and facilitate the process of conducting experiments and evaluations using Azure Cognitive Search and RAG pattern.
★ 303Pythonupdated 2026-04-20acsazurechunkingdenseembedding
Holistic Evaluation of Language Models (HELM) is an open source Python framework created by the Center for Research on Foundation Models (CRFM) at Stanford for holistic, reproducible and transparent evaluation of foundation models, including large language models (LLMs) and multimodal models.
★ 2,773Pythonupdated 2026-04-24
Article extraction benchmark: dataset and evaluation scripts
★ 365Pythonupdated 2026-04-23
Well tested & Multi-language evaluation framework for text summarization.
★ 626Pythonupdated 2026-04-13bleumachine-learningrougetext-summarization
A framework for standardizing evaluations of large foundation models, beyond single-score reporting and rankings.
★ 183Pythonupdated 2026-04-15aiartificial-intelligenceevaluation-frameworkllmmachine-learning
HarmBench: A Standardized Evaluation Framework for Automated Red Teaming and Robust Refusal
★ 936Jupyter Notebookupdated 2024-08-16
An automatic evaluator for instruction-following language models. Human-validated, high-quality, cheap, and fast.
★ 1,977Jupyter Notebookupdated 2025-08-09deep-learningevaluationfoundation-modelsinstruction-followinglarge-language-models
Evaluation harness for OpenHands V1.
★ 75Pythonupdated 2026-04-25
Provider-agnostic, open-source evaluation infrastructure for language models
★ 764Pythonupdated 2026-03-16managed-by-terraform
A tool for evaluating LLMs
★ 430TypeScriptupdated 2026-03-15llmmlops
RewardBench: the first evaluation tool for reward models.
★ 713Pythonupdated 2026-02-16preference-learningrlhf
Readymade evaluators for agent trajectories
★ 569Pythonupdated 2026-04-21
Easily fine-tune, evaluate and deploy gpt-oss, Qwen3, DeepSeek-R1, or any open source LLM / VLM!
★ 9,209Pythonupdated 2026-04-24dpoevaluationfine-tuninggpt-ossgpt-oss-120b
A framework for serving and evaluating LLM routers - save LLM costs without compromising quality
★ 4,835Pythonupdated 2024-08-10
🤖 A Python library for learning and evaluating knowledge graph embeddings
★ 1,983Pythonupdated 2026-04-21cudadeep-learningknowledge-base-completionknowledge-graph-embeddingsknowledge-graphs
[CVPR 2025] A Comprehensive Benchmark for Document Parsing and Evaluation
★ 1,692Pythonupdated 2026-04-20
An MCP server that autonomously evaluates web applications.
★ 1,239Pythonupdated 2026-02-11debuggingdebugging-toolmcpmcp-servermodelcontextprotocol
Evaluate your LLM-powered apps with TypeScript
★ 1,487TypeScriptupdated 2026-03-27aievalstypescript
Code, Build and Evaluate agents - excellent Model and Skills/MCP/ACP Support
★ 3,757Pythonupdated 2026-04-23acpagentagent-frameworkagent-skillscli
An open source reinforcement learning framework for training, evaluating, and deploying robust trading agents.
★ 6,202Pythonupdated 2026-02-19
bloom - evaluate any behavior immediately  🌸🌱
★ 1,301Pythonupdated 2026-02-17
🐢 Open-Source Evaluation & Testing library for LLM Agents
★ 5,307Pythonupdated 2026-04-25agent-evaluationai-red-teamai-securityai-testingfairness-ai
Every Eval Ever is a shared schema and crowdsourced eval database. It defines a standardized metadata format for storing AI evaluation results — from leaderboard scrapes and research papers to local evaluation runs — so that results from different frameworks can be compared, reproduced, and reused.
★ 59Pythonupdated 2026-04-25agent-evaluationai-evaluationevaluationsinfrallm-evaluation
🤗 Evaluate: A library for easily evaluating machine learning models and datasets.
★ 2,444Pythonupdated 2026-04-17evaluationmachine-learning
Harbor is a framework for running agent evaluations and creating and using RL environments.
★ 1,698Pythonupdated 2026-04-25evalsrl-environmentsterminal-bench
Inspect: A framework for large language model evaluations
★ 1,974Pythonupdated 2026-04-25
AI Observability & Evaluation
★ 9,473Pythonupdated 2026-04-25agentsai-monitoringai-observabilityaiengineeringanthropic
A curated list of amazingly awesome open source resources related to broadcast technologies
★ 1,706updated 2026-03-08awesome-listbroadcastbroadcasting
Kodi is an award-winning free and open source home theater/media center software and entertainment hub for digital media. With its beautiful interface and powerful skinning engine, it's available for Android, BSD, Linux, macOS, iOS, tvOS and Windows.
★ 20,703C++updated 2026-04-24androidc-plus-plusentertainment-hubhacktoberfesthome-theater
A curated list of FOSS Android TV apps
★ 1,201updated 2026-03-10androidandroidtvfosssmarttv
Youmind Claude/Codex skill with browser automation and smart-add workflow
★ 44Pythonupdated 2026-03-03
Open-source Claude Design alternative. One-click import your Claude Code / Codex API key. Prompt → prototype / slides / PDF. Multi-model (Claude, GPT, Gemini, Kimi, GLM, Ollama). BYOK, local-first, MIT.
★ 3,281TypeScriptupdated 2026-04-24ai-designanthropicbyokclaudeclaude-code
Brower extension to convert web pages to clean Markdown and copy to clipboard so you can feed it to your favorite LLM model as context with just 1 click!
★ 386JavaScriptupdated 2026-03-30aiautomationbrowserchrome-extensiondeveloper-tools
A blazing fast, async-first, undetectable webscraping/web automation framework based on ultrafunkamsterdam/nodriver. Now with Docker support!
★ 1,255Pythonupdated 2026-04-19anti-botasyncbot-detectionbrowserbrowser-automation
Build complex browser workflows visually and execute them via API.
★ 425TypeScriptupdated 2026-04-21agentic-tasksapiautomationbrowser-automationheadless
AI-powered browser automation MCP server for Claude Code. Navigate, click, screenshot, test — all from your terminal.
★ 146TypeScriptupdated 2026-04-16aiai-agentbrowser-automationclaudeclaude-code
Browser automation engine benchmark - Test bypass rates, performance & stealth against Cloudflare, DataDome, reCAPTCHA and other bot detection systems. Find the best browser for scraping.
★ 291Pythonupdated 2026-04-12anti-detectantidetect-browserautomationbrowsercaptcha
🤖 An AI-powered desktop automation agent built with Electron & Next.js - Control your computer like manus, but as a native desktop app, an ai browser!
★ 148TypeScriptupdated 2026-04-03agent-browseragentic-browserai-browseraltasbrowser-assistant
Web-Use is a CDP powered Browser Agent
★ 257Pythonupdated 2026-04-24agentautomationbrowserllmweb
ZeroToken — Record once, automate forever. A lightweight MCP for agent-driven browser automation, script recording, and scheduled execution.
★ 436Pythonupdated 2026-03-12
MCP Server connecting to Perplexity Comet browser
★ 152TypeScriptupdated 2026-01-13agentic-aiagentic-browserautomationmcp-server
Browser automation system that uses AI-driven planning to navigate web pages and perform goals.
★ 860Pythonupdated 2026-03-11agentsaiautomation-frameworkautomation-uibrowser
AI Browser Automation Framework
★ 170TypeScriptupdated 2026-04-17ai-agentsbrowser-automationopen-sourceplaywrighttypescript
A browser extension that helps users publish content to multiple social media platforms with one click.
★ 2,183TypeScriptupdated 2026-03-03articleautomationcontent-platformmarketingmarketing-automation
The only browser automation that bypasses anti-bot systems. AI writes network hooks, clones UIs pixel-perfect via simple chat.
★ 501Pythonupdated 2026-03-22ai-agent-toolsai-toolsanthropicanti-bot-bypassautomation-tools
a stealthy browser automation framework
★ 852Pythonupdated 2025-04-25automationdetection-evasiondriverless-chromepythonpython3
Advanced GenAI Legal Ecosystem for Israeli Law. Powered by Autonomous Agents, Multi-Step Tool Calling (Skills), and Gemini Pro. Architected for Precision with RAG, Vector Embeddings, and Agentic Workflows to deliver
★ 1Pythonupdated 2026-04-21
The AI Browser Automation Framework
★ 462Pythonupdated 2026-04-23
Apache Geb: Very Groovy Browser Automation
★ 1,168Groovyupdated 2026-04-17apachebdd-style-testing-frameworkbrowser-testingdevtoolse2e-testing
Give your AI the power to browse, scrape, and extract structured data from complex websites — with faster execution, lower cost, and more reliable results.
★ 704Pythonupdated 2026-04-24ai-agentsautomationclaude-codeclaude-code-skillscursor
Unbrowse — api native browser skill/cli for any agent. Auto-discovers APIs from browser traffic, generates skills on the fly to call APIs directly 100x faster, 80% cheaper locally.
★ 643TypeScriptupdated 2026-04-11agentsagentskillsbrowser-useclawdbotclawdbot-plugin
Sentiment Analysis, Text Classification, Text Augmentation, Text Adversarial defense, etc.;
★ 1,096Jupyter Notebookupdated 2026-04-24adversarialaspect-based-sentiment-analysisaspect-sentiment-triplet-extractionaspect-term-extractionlcf-bert
Julia package for text analysis
★ 382Juliaupdated 2026-04-08
Simple, Pythonic, text processing--Sentiment analysis, part-of-speech tagging, noun phrase extraction, translation, and more.
★ 9,516Pythonupdated 2026-04-21natural-language-processingnlpnltkpatternpython
Vizro is a low-code toolkit for building high-quality data visualization apps.
★ 3,674Pythonupdated 2026-04-23dashboarddata-visualizationplotlyplotly-dashpydantic
A charting and data visualization library for Unity. Unity数据可视化图表插件。
★ 3,735C#updated 2026-03-29chartchartingdata-visualizationgraphicsugui
Java dataframe and visualization library
★ 3,748Javaupdated 2026-03-02chartdata-analysisdata-framedata-sciencedata-visualization
DeepAnalyze is the first agentic LLM for autonomous data science. 🎈你的AI数据分析师,自动分析大量数据,一键生成专业分析报告!
★ 4,087Pythonupdated 2026-04-13agentagenticagentic-aiaiai-scientist
Preswald is a WASM packager for Python-based interactive data apps: bundle full complex data workflows, particularly visualizations, into single files, runnable completely in-browser, using Pyodide, DuckDB, Pandas, and Plotly, Matplotlib, etc. Build dashboards, reports, and notebooks that run offline, load fast, and share like a document.
★ 4,286Pythonupdated 2026-04-14aianalyticsanalytics-engineeringcopilotdata
Dashboards and notebooks in a single place. Create powerful and flexible dashboards using code, or build beautiful Notion-like notebooks and share them with your team.
★ 4,301TypeScriptupdated 2025-08-07analyticsbibigquerybrieferbusiness-intelligence
Create web apps from Python notebooks
★ 4,312Pythonupdated 2026-04-17data-sciencedata-visualizationjupyterjupyter-labjupyter-notebook
A curated list of awesome Jupyter projects, libraries and resources
★ 4,596updated 2026-04-24awesomeawesome-listdata-sciencedata-visualizationfrontend
Next generation of automated data exploratory analysis and visualization platform.
★ 4,634TypeScriptupdated 2026-03-10augmented-analyticsautomated-data-analysisautomated-visualizationautoviscausal-discovery
A lightweight next-gen data explorer - Postgres, MySQL, SQLite, MongoDB, Redis, MariaDB, Elastic Search, and Clickhouse with Chat interface
★ 4,759Goupdated 2026-04-23anthropicclickhousedata-analysisdata-visualizationdatabase
Visualizer for pandas data structures
★ 5,108TypeScriptupdated 2026-04-23data-analysisdata-sciencedata-visualizationflaskipython
A concise API for exploratory data visualization implementing a layered grammar of graphics
★ 5,252HTMLupdated 2026-04-16chartsd3data-visualizationsvgvisualization
Powerful data visualization library based on G2 and React.
★ 6,198TypeScriptupdated 2025-05-23chartdata-visualizationes6grammarhtml5-canvas
Data processing for and with foundation models! 🍎 🍋 🌽 ➡️ ➡️🍸 🍹 🍷
★ 6,356Pythonupdated 2026-04-24datadata-analysisdata-pipelinedata-processingdata-science
Open source CSS framework for data visualization.
★ 6,559HTMLupdated 2026-04-04chartchartscsscss-frameworkdata-visualization
Visually explore, understand, and present your data.
★ 7,120TypeScriptupdated 2026-04-15data-visualizationdeck-glmsr-vidapowerbivega
Python Data. Leaflet.js Maps.
★ 7,360Pythonupdated 2026-04-23data-sciencedata-visualizationjavascriptmapspython
📱📈An elegant, interactive and flexible charting library for mobile.
★ 7,989JavaScriptupdated 2026-04-17antvchartsdata-visualisationdata-visualizationf2
React friendly API wrapper around MapboxGL JS
★ 8,445TypeScriptupdated 2026-04-11data-visualizationmapmapbox-glmapbox-gl-jsreact
:bar_chart: A D3-based reusable chart library
★ 9,349JavaScriptupdated 2026-04-14chartd3data-visualizationgraphgraphics
📈 A small, fast chart for time series, lines, areas, ohlc & bars
★ 10,102JavaScriptupdated 2026-04-22analyticschartchartsdata-visualizationgraph
A data visualization and analytics component, especially well-suited for large and/or streaming datasets.
★ 10,457C++updated 2026-04-23analyticsbidata-visualizationjavascriptjupyter
A JavaScript library aimed at visualizing graphs of thousands of nodes and edges
★ 12,000TypeScriptupdated 2026-04-23data-visualizationgraphgraph-drawinggraph-drawing-frameworkgraphs
♾ A Graph Visualization Framework in JavaScript.
★ 12,094TypeScriptupdated 2026-04-17data-visualizationgraphgraph-analyticsgraph-drawinggraph-visualization
Statistical data visualization in Python
★ 13,830Pythonupdated 2026-01-22data-sciencedata-visualizationmatplotlibpandaspython
WebGL2 powered visualization framework
★ 14,128TypeScriptupdated 2026-04-23data-visualizationgeospatial-analysisjavascriptmapspython
📊 Interactive JavaScript Charts built on SVG
★ 15,096JavaScriptupdated 2026-04-15chartsdata-visualizationgraphsinteractivejavascript
Open-source JavaScript charting library behind Plotly and Dash
★ 18,176JavaScriptupdated 2026-04-23charting-librarychartsd3data-visualizationplotly
Turns Data and AI algorithms into production-ready web applications in no time.
★ 19,178Pythonupdated 2026-04-22automationdata-engineeringdata-integrationdata-opsdata-visualization
🐯 visx | visualization components
★ 20,767TypeScriptupdated 2026-04-14chartd3data-visualizationreactsvg
The HTML5 Creation Engine: Create beautiful digital content with the fastest, most flexible 2D WebGL renderer.
★ 47,059TypeScriptupdated 2026-04-23canvascanvas2ddata-visualizationgameglsl
Performant financial charts built with HTML5 canvas
★ 15,402TypeScriptupdated 2026-04-20canvaschartingcharting-librarychartsfinance
FL Chart is a highly customizable Flutter chart library that supports Line Chart, Bar Chart, Pie Chart, Scatter Chart, Radar Chart and Candlestick Chart.
★ 7,504Dartupdated 2026-04-21barchartcandlestickcandlestick-chartcandlestickschart
Simple responsive charts
★ 13,399TypeScriptupdated 2026-04-13charting-librarychartistjavascriptresponsive-chartssvg
Simple HTML5 Charts using the <canvas> tag
★ 67,397JavaScriptupdated 2026-04-16canvaschartgraphhtml5html5-charts
A powerful, format-agnostic, and community-driven Python package for analysing and visualising Earth science data
★ 715Pythonupdated 2026-04-20data-analysisearth-sciencegribirismeteorology
Visualise your Kedro data and machine-learning pipelines and track your experiments.
★ 748JavaScriptupdated 2026-04-22data-visualizationexperiment-trackinghacktoberfestkedrokedro-plugin
All sorts of useful information about every country packaged as convenient little country objects. It includes data from ISO 3166 (countries and states/subdivisions ), ISO 4217 (currency), and E.164 (phone numbers).
★ 2,336Rubyupdated 2026-02-25countriesiso3166ruby
Claude Code skills for journalism, media, and academia - verification, FOIA, data journalism, academic writing, and more
★ 170HTMLupdated 2026-04-22academic-writingclaudeclaude-codeclaude-skillsdata-journalism
AI Product Analyst — Claude Code-powered data analysis toolkit
★ 189Pythonupdated 2026-04-16
Microsoft Dataverse skills for AI coding agents. Wraps the Dataverse MCP server, Dataverse CLI, Python SDK, and PAC CLI behind specialist skills for building, querying, deploying, and administering Dataverse environments.
★ 80updated 2026-04-24agent-skillsdataversedynamics-365dynamics-crmmcp
Opinionated skills for AI coding agents to create stunning diagrams and visualizations directly in Markdown. These skills extend agent capabilities across diagram generation, data visualization, and technical documentation.
★ 2,290updated 2026-04-23
A PHP library providing ISO 3166-1 data.
★ 699PHPupdated 2026-03-30hacktoberfest
GeoJSON utilities that will make your life easier.
★ 2,485updated 2026-02-01awesomeawesome-listgeojsonlist
Python bindings and utilities for GeoJSON
★ 985Pythonupdated 2026-01-05geojsonpython
A quick, simple tool for creating, viewing, and sharing spatial data
★ 2,142TypeScriptupdated 2026-04-21geojson
Interactive Data Visualization in the browser, from Python
★ 20,377TypeScriptupdated 2026-04-23bokehdata-visualisationinteractive-plotsjavascriptjupyter
Anomaly detection related books, papers, videos, and toolboxes. Last update late 2025 for LLM and VLM works!
★ 9,270Pythonupdated 2026-03-02anomaly-detectionawesomeawesome-listdata-miningfraud
Flexible and powerful data analysis / manipulation library for Python, providing labeled data structures similar to R data.frame objects, statistical functions, and much more
★ 48,595Pythonupdated 2026-04-23alignmentdata-analysisdata-scienceflexiblepandas
Chat with your data - AI data analysis and visualization on CSV, Postgres, MySQL, Snowflake, SQLite...
★ 1,550TypeScriptupdated 2026-02-11aichartdata-sciencedata-visualizationllm
MDD & Annotation-driven Low-code Data platform & AI Harness
★ 2,708Javaupdated 2026-04-23adminaiannotationeruptflow
Open, Multi-modal Catalog for Data & AI
★ 3,372Javaupdated 2026-04-24
A logical, reasonably standardized, but flexible project structure for doing and sharing data science work.
★ 9,805Pythonupdated 2026-04-09aicookiecuttercookiecutter-data-sciencecookiecutter-templatedata-science
🪄 Create rich visualizations with AI
★ 15,245TypeScriptupdated 2026-04-23
50,000+ unique HTML presentation designs. Zero dependencies. Anti-AI-slop. A Claude Code skill.
★ 17Pythonupdated 2026-04-01anti-ai-slopclaude-codedesign-systemhtml-slidespresentations
A Claude Skill for creating academic presentations (conference talks, seminar slides, thesis defenses, grant briefings). Enforces action titles, structured argument, exhibit discipline, citation standards, and communication-first design. Works alongside Anthropic's built-in PPTX skill.
★ 309updated 2026-03-02
MARP presentation skill for Claude Code — 22 curated example decks, SVG charts, dark/light themes, dashboard components
★ 155updated 2026-04-08
Claude Code skill for making reveal.js presentations
★ 277JavaScriptupdated 2026-02-16
AI generates natively editable PPTX from any document — real PowerPoint shapes, not images — no design skills needed · by Hugo He
★ 8,823Pythonupdated 2026-04-23ai-agentaipptofficepowerpointpowerpoint-generation
Typst template suite for papers, presentation slides, exams, and more!
★ 107Typstupdated 2026-04-02
Agent skill that generates rich HTML pages or slide decks for diagrams, diff reviews, plan audits, data tables, and project recaps
★ 7,751HTMLupdated 2026-03-29
deck is a tool for creating deck using Markdown and Google Slides.
★ 1,207Goupdated 2026-04-19deckgoogle-slidesmarkdownslide
MCP Server for Google Slides
★ 176TypeScriptupdated 2025-06-30
Lean, hackable, extensible slide deck framework. Previously known as CSSS.
★ 1,750JavaScriptupdated 2026-04-01presentationslidedeckslideshow
The entrance repository of Markdown presentation ecosystem
★ 11,517TypeScriptupdated 2026-04-12deckmarkdownmarppresentationslides
ALLWEONE® Open source AI presentation generator Gamma Alternative. Create professional slides with customizable themes and AI-generated content in minutes.
★ 2,768TypeScriptupdated 2026-04-04aiall-in-oneallweonegammagenerative-ai
Presentation Slides for Developers
★ 46,042TypeScriptupdated 2026-04-23markdownpresentationslidesvitevue
The HTML Presentation Framework
★ 71,075JavaScriptupdated 2026-04-20presentationsslidesslideshow
Crawlee—A web scraping and browser automation library for Python to build reliable crawlers. Extract data for AI, LLMs, RAG, or GPTs. Download HTML, PDF, JPG, PNG, and other files from websites. Works with Parsel, BeautifulSoup, Playwright, and raw HTTP. Both headful and headless mode. With proxy rotation.
★ 8,822Pythonupdated 2026-04-23apifyautomationbeautifulsoupcrawlercrawling
⌥ AI Coding agent for the terminal — hash-anchored edits, optimized tool harness, LSP, Python, browser, subagents, and more
★ 3,508TypeScriptupdated 2026-04-18ai-agentai-coding-agentanthropicbunclaude
🤖 AI browser extensions & userscripts to augment your web experience
★ 541JavaScriptupdated 2026-04-23aiamazonartificialintelligencebravechat
Your AI friend right in your browser
★ 522TypeScriptupdated 2026-04-12agentaibrowser-automationbrowser-extensionmodel-agnostic
The headless browser for AI agents and web scraping
★ 6,416Rustupdated 2026-04-13
MCP server for fetch web page content using Playwright headless browser.
★ 1,032TypeScriptupdated 2026-01-14aimcpplaywright
Stealth headless browser for AI agents — bypass Cloudflare, bot detection, and anti-scraping. Drop-in Puppeteer/Playwright replacement.
★ 3,273JavaScriptupdated 2026-04-19ai-agentanti-botantidetect-browserautomationbot-detection
Run local LLMs like llama, deepseek-distill, kokoro and more inside your browser
★ 1,404TypeScriptupdated 2026-04-22agentsaillamallmllm-inference
Python & Command-line tool to gather text and metadata on the Web: Crawling, scraping, extraction, output as CSV, JSON, HTML, MD, TXT, XML
★ 5,802Pythonupdated 2025-09-12article-extractorcorpus-buildercorpus-toolscrawlerhtml-to-markdown
Religious Values Benchmark Meta-Evaluation Dashboard — 401 candidates, 14 traditions, 9 LLMs, 12-member expert council review
★ 1HTMLupdated 2026-04-13
Meeting Minutes of the AI Council — Ten Leading AI Models Deliberate on the Human-Machine Trust Crisis Triggered by the Claude Mythos.A transparent experiment for human-AI symbiosis governance.(本项目和会议都是在中文环境下完成,若想看到英文版请自行翻译。)
★ 2updated 2026-04-20aiai-governanceai-safetychinesecommunity
A decision operating system for high-stakes choices — business, strategy, career. Simulates disagreement, stress-tests assumptions, and converges on what actually holds up. Claude Code skill inspired by Karpathy's autoresearch + LLM council.
★ 70Pythonupdated 2026-04-20
AI Presidential Briefing: Daily knowledge synthesis system with memory layer, LLM council, and LinkedIn post generation
★ 1Pythonupdated 2026-04-23
Official Implementation of MultiWorld: Scalable Multi-Agent Multi-View Video World Models
★ 136Pythonupdated 2026-04-21action-conditioneddiffusion-modelsgame-generationinteractive-videomulti-agent
DuckDB is an analytical in-process SQL database management system
★ 37,732C++updated 2026-04-23analyticsdatabaseembedded-databaseolapsql
★ 1,195Pythonupdated 2026-04-23
AI powered open source recommender system engine supports classical/LLM rankers and multimodal content via embedding
★ 9,619Goupdated 2026-04-22collaborative-filteringgoknnmachine-learningrecommender-system
Best and simplest tool for website change detection, web page monitoring, and website change alerts. Perfect for tracking content changes, price drops, restock alerts, and website defacement monitoring—all for free or enjoy our SaaS plan!
★ 31,256Pythonupdated 2026-04-23back-in-stockchange-alertchange-detectionchange-monitoringmonitoring
A modern, web-based SSH console and key management tool. Bastillion gives you a clean, browser-based way to manage SSH access across all your systems. Think of it like a bastion host with a friendly dashboard.
★ 3,463Javaupdated 2026-04-15bastion-hostjavajavascriptsshssh-client
Vuestic Admin is an open-source, ready-to-use admin template suite designed for rapid development, easy maintenance, and high accessibility. Built on Vuestic UI, Vue 3, Vite, Pinia, and Tailwind CSS. Maintained by Epicmax (@epicmaxco).
★ 10,954Vueupdated 2026-02-26admin-dashboardadmin-dashboard-uiadmin-paneladmin-templateadmin-tools
Data compiled by the Institute for National Security Studies (INSS), an Israeli think tank affiliated with Tel Aviv University. These figures were widely cited in reports published on Feb 28 - March 5, 2026, by outlets such as The New Arab, Middle East Eye, and CBS News.
★ 6JavaScriptupdated 2026-03-06
A curated list of Awesome Threat Intelligence resources
★ 10,122updated 2026-01-19awesomeawesome-listhacktoberfestsecurity
Python based framework to retreive Global Database of Events, Language, and Tone (GDELT) version 1.0 and version 2.0 data.
★ 249Jupyter Notebookupdated 2023-11-30data-framegdeltgeolocationgeospatial-dataglobal-database
🏔️ The AI-native RSS reader
★ 381TypeScriptupdated 2026-04-10aillmnews-readerreactrss
The open agent skills tool - npx skills
★ 16,074TypeScriptupdated 2026-04-22
Captcha solver extension for humans, available for Chrome, Edge and Firefox
★ 9,038JavaScriptupdated 2026-04-19browser-extensioncaptchacaptcha-solvercaptcha-solvingchrome-extension
Objectron is a dataset of short, object-centric video clips. In addition, the videos also contain AR session metadata including camera poses, sparse point-clouds and planes. In each video, the camera moves around and above the object and captures it from different views. Each object is annotated with a 3D bounding box. The 3D bounding box describes the object’s position, orientation, and dimensions. The dataset contains about 15K annotated video clips and 4M annotated images in the following categories: bikes, books, bottles, cameras, cereal boxes, chairs, cups, laptops, and shoes
★ 2,327Jupyter Notebookupdated 2026-03-063d3d-reconstruction3d-visionaiaugmented-reality
Visualize, share and annotate your large 3D images online
★ 173TypeScriptupdated 2026-04-23connectomicsemhacktoberfestmicroscopymicroscopy-images
Open-source multimodal data annotation platform with AI auto-annotation support.
★ 1,555Pythonupdated 2026-04-22
CLI for common Playwright actions. Record and generate Playwright code, inspect selectors and take screenshots.
★ 9,347TypeScriptupdated 2026-04-14playwright
WebDriver Screenshot utility. Take screenshots, crop, prettify, compare
★ 655Javaupdated 2026-04-19comparisoncropscreenshotwebdriver
Claude Code Skill for browser automation with Playwright. Model-invoked - Claude autonomously writes and executes custom automation for testing and validation.
★ 2,498JavaScriptupdated 2025-12-19ai-toolsautomationbrowser-automationclaudeclaude-code
The headless Chrome/Chromium driver on top of Puppeteer. Take screenshots, generate PDFs, extract text and HTML with a production-ready API.
★ 1,801JavaScriptupdated 2026-04-22automationbrowser-automationchromiumlighthousepdf-generation
AIPex: AI browser automation assistant, no migration and privacy first. Alternative to Manus Browser Operator、 Claude Chrome and Agent Browser
★ 1,154TypeScriptupdated 2026-04-13accessbility-testingagent-browseragent-skillsbrowser-automationbrowser-use
BrowserWing turns your browser actions into MCP commands Or Claude Skill, allowing AI agents to control browsers efficiently and reliably. Say goodbye to slow, token-heavy LLM interactions — let agents call commands directly for faster automation. Perfect for AI-driven tasks, browser automation, and boosting productivity.
★ 1,247Goupdated 2026-04-21aibrowsergolangllmreact
APIs for browser automation, testing, and bypassing bot-detection.
★ 12,642Pythonupdated 2026-04-23anti-detectionbot-detectionchromedriverchromiume2e-testing
🤖 Telegram Bot API PHP SDK. Lets you build Telegram Bots easily! Supports Laravel out of the box.
★ 3,289PHPupdated 2026-04-01botbot-frameworkbotkitchatbotcomposer-packages
🔥 The open-source no-code platform for web scraping, crawling, search and AI data extraction • Turn websites into structured APIs in minutes 🔥
★ 15,528TypeScriptupdated 2026-04-23agentsapiautomationbrowser-automationcrawler
The web browser built for scraping
★ 1,516TypeScriptupdated 2026-04-23
Open Source Intelligence Interface for Deep Web Scraping
★ 1,580Pythonupdated 2026-04-08ahmiadeep-web-searchosinttor
ClawFeed — AI-powered news digest with structured summaries from Twitter/RSS feeds and web dashboard
★ 2,201HTMLupdated 2026-03-04
A GPU-accelerated cross-platform terminal emulator and multiplexer written by @wez and implemented in Rust
★ 25,729Rustupdated 2026-04-23rustserialserial-portterminalterminal-emulator
Terminal UI OS (Terminal Multiplexer)
★ 2,607Goupdated 2026-04-13bubbleteacharmgomultiplexerpty
Security scanner for AI agents, MCP servers and agent skills.
★ 2,253Pythonupdated 2026-04-23agentaimcpmodelcontextprotocolsecurity
MCP Server for Metasploit
★ 590Pythonupdated 2026-02-05
GNU Radio – the Free and Open Software Radio Ecosystem
★ 6,052C++updated 2026-04-21c-plus-pluscybersecuritydspgnugnuradio
IPTV Simple client for Kodi PVR
★ 911C++updated 2026-04-23hacktoberfest
Autoupdate iptv sources
★ 8,715TypeScriptupdated 2026-04-23diypdockeriptviptv-channelsiptv-m3u
A list of RSS related stuff: tools, services, communities and tutorials, etc.
★ 5,783SCSSupdated 2026-03-15all-in-oneappsatom-feedatomfeedcommunity
🧡 Folo is the AI RSS Reader
★ 38,154TypeScriptupdated 2026-04-18aireaderrssrss-readerrsshub
The RSS feed for websites missing it
★ 8,899PHPupdated 2026-04-03atom-feedhacktoberfestjson-feedphprss
MCP server for Google News and Google Trends
★ 76Pythonupdated 2026-03-29
Use Google News Scraper API to obtain the latest global news for your project, including a wide range of sources, headlines, URLs, and publication dates from the Google News platform.
★ 2,788Pythonupdated 2026-03-25api-for-google-newsapi-google-newsapi-stock-newsfree-google-news-apigoogle-news-api
Lightweight scraper for Google News
★ 373TypeScriptupdated 2026-02-20crawlergoogle-crawlergoogle-newsgoogle-news-scrapernews
Real-time dashboard for monitoring global news, markets, and geopolitical events
★ 4,099TypeScriptupdated 2026-01-13
📰 Newspaper4k a fork of the beloved Newspaper3k. Extraction of articles, titles, and metadata from news websites.
★ 1,090Pythonupdated 2026-04-11articlesarticles-datacrawlerdatasets-preparationnews
An RSS/Atom feed reader for text terminals
★ 3,772C++updated 2026-04-17atom-feed-readernewsbeuterrss-feed-reader
news-please - an integrated web crawler and information extractor for news that just works
★ 2,441Pythonupdated 2026-04-14cc-newsccnewscommoncrawlcrawlerdata-gathering
newspaper3k is a news, full-text, and article metadata extraction in Python 3. Advanced docs:
★ 15,034Pythonupdated 2026-04-16crawlercrawlingnewsnews-aggregatorpython
Elegant reading of real-time and hottest news
★ 19,648TypeScriptupdated 2026-02-27elegantnews
Event-driven AI pipeline that monitors breaking news in real time, classifies market impact with Claude, and trades niche Polymarket markets automatically.
★ 260Pythonupdated 2026-04-03ai-tradingalgorithmic-tradingautomationclaudepolymarket
Real-time Polymarket prediction market visualization dashboard with an interactive world map.
★ 168TypeScriptupdated 2026-03-27bettingmonitoringmonitoring-toolnewspolymarket
Professional Wargaming LLM Toolbox
★ 23Pythonupdated 2025-07-09
A wargaming platform compatible with reinforcement learning agents
★ 87TypeScriptupdated 2025-09-09agent-based-simulationaiartificial-intelligencegame-enginemachine-learning
⏰ Modern datetime library for Python
★ 2,332Pythonupdated 2026-04-22cpythondatetimemypypure-pythonpypy
CLI tool to convert a natural language date/time string to UTC
★ 257Rustupdated 2026-03-29clicli-tooldatedatetimeiso8601
GNOME Shell extension for showing UTC time on the top bar
★ 16JavaScriptupdated 2026-03-15gnomegnome-shell-extensiontimezoneutc
The specification for the Universal Tool Calling Protocol
★ 297TypeScriptupdated 2026-04-23aiai-agent-toolsdocumentationmcpprotocol
Get time zones for coordinates
★ 109PHPupdated 2026-02-23coordinatesgeocodingphptimezone
JavaScript library to transform coordinates from one coordinate system to another, including datum transformations
★ 2,213JavaScriptupdated 2026-04-22datum-transformationsepsggeospatialgisjavascript
🌎 Large-scale WebGL-powered Geospatial Data Visualization analysis engine.
★ 3,993TypeScriptupdated 2026-04-203damapantvdata-visualizationgeojson
Bringing the 3D geospatial ecosystem to Unreal Engine
★ 1,166C++updated 2026-04-223dtilescesiumgeospatialue4unreal-engine-plugin
Official GeoTools repository
★ 1,902Javaupdated 2026-04-23geojsongeospatialgeotoolsgisjava
A Python package for segmenting geospatial data with the Segment Anything Model (SAM)
★ 3,974Pythonupdated 2026-04-20artificial-intelligencedeep-learninggeopythongeospatialmachine-learning
Python tools for geographic data
★ 5,109Pythonupdated 2026-04-13geoparquetgeospatialpandaspythonspatial
😎Awesome GIS is a collection of geospatial related sources, including cartographic tools, geoanalysis tools, developer tools, data, conference & communities, news, massive open online course, some amazing map sites, and more.
★ 5,325updated 2026-03-29awesomegeogeospatialgeospatial-librarygeotools
Real-time Geospatial and Geofencing
★ 9,623Goupdated 2026-03-19databasegeogeofencesgeospatialindex
A modular geospatial engine written in JavaScript and TypeScript
★ 10,341TypeScriptupdated 2026-04-23algorithmcomputational-geometrygeojsongeospatialgis
An open-source JavaScript library for world-class 3D globes and maps :earth_americas:
★ 15,174JavaScriptupdated 2026-04-233d3d-globe3d-tilescesiumczml
CARS is a dedicated and open source 3D tool to produce Digital Surface Models from satellite imaging by photogrammetry.
★ 377Pythonupdated 2026-04-23image-processingphotogrammetrypythonremote-sensing
A Python package for installing commonly used packages for geospatial analysis and data visualization with only one command.
★ 419Dockerfileupdated 2026-03-16geemapgeopandasgeospatialgisimage-processing
A python package that extends Google Earth Engine.
★ 448Pythonupdated 2026-04-01earth-enginegeographic-information-systemsgisgooglegoogle-earth-engine
🛰️ Official repository of paper "RemoteCLIP: A Vision Language Foundation Model for Remote Sensing" (IEEE TGRS)
★ 541Jupyter Notebookupdated 2024-06-27contrastive-language-image-pretrainingremote-sensingvision-language
A collection of tools to work with Google Earth Engine Python API
★ 562Pythonupdated 2026-04-21earthenginegeospatialgoogle-earth-enginepythonremote-sensing
framework for large-scale SAR satellite data processing
★ 596Pythonupdated 2026-04-22earth-observationgdalpythonradarremote-sensing
Python Library for NASA Earthdata APIs
★ 602Pythonupdated 2026-04-22accessclimate-datacloud-computingcmrdata
Python module for hyperspectral image processing
★ 662Pythonupdated 2026-04-12anomaly-detectionhyperspectralhyperspectral-image-classificationimage-processingpython
:globe_with_meridians: List & Map of 790+ companies for geospatial jobs (GIS, Earth Observation, UAV, Satellite, Digital Farming, ..)
★ 850Pythonupdated 2026-04-05companiesearth-observationfarminggeospatialgis
Global shoreline mapping tool from satellite imagery
★ 862Jupyter Notebookupdated 2025-11-01coastal-engineeringearth-enginegeospatialgoogle-earth-enginejupyter-notebook
A collection of Python packages for geospatial analysis with binder-ready notebook examples
★ 878Shellupdated 2024-07-04binderbinder-readygeoprocessinggeospatialgeospatial-analysis
Search and download Copernicus Sentinel satellite images
★ 1,011Pythonupdated 2024-10-02copernicusesageographic-datahacktoberfestopen-data
GRASS - free and open-source geospatial processing engine
★ 1,102Cupdated 2026-04-22arraysdata-scienceearth-observationgeospatialgeospatial-analysis
Community Datasets added by users and made available for use at large
★ 1,142HTMLupdated 2026-04-23awesome-listcatalogcommunity-catalogcommunity-datasetsearth-engine
A curated list of Google Earth Engine resources
★ 1,196updated 2026-03-11earth-engineearthenginegeospatialgisgoogle-earth-engine
A collection of 360+ Jupyter Python notebook examples for using Google Earth Engine with interactive mapping
★ 1,535Jupyter Notebookupdated 2021-03-16earth-engineearthenginegeospatialgisgoogle-earth-engine
A comprehensive and up-to-date compilation of datasets, tools, methods, review papers, and competitions for remote sensing change detection.
★ 2,199updated 2026-04-16awesomechange-detectiondatasetdeep-learningremote-sensing
An open source library and framework for deep learning on satellite and aerial imagery.
★ 2,215Pythonupdated 2025-09-29classificationcomputer-visiondeep-learninggeospatialmachine-learning
GeoAI: Artificial Intelligence for Geospatial Data
★ 2,913Pythonupdated 2026-04-15aidata-sciencedeep-learningearth-observationgeoai
🛰️ List of satellite image training datasets with annotations for computer vision and deep learning
★ 3,884updated 2022-07-14computer-visiondeep-learningearth-observationinstance-segmentationmachine-learning
A Python package for interactive geospatial analysis and visualization with Google Earth Engine.
★ 3,935Pythonupdated 2026-04-22colabdata-sciencedatavizearth-engineearthengine
TorchGeo: datasets, samplers, transforms, and pre-trained models for geospatial data
★ 4,004Pythonupdated 2026-04-22computer-visiondatasetsdeep-learningearth-observationgeospatial
Long list of geospatial tools and resources
★ 4,977updated 2026-04-22awesomeawesome-listdata-analysisdeep-learningearth-observation
Download and process satellite imagery in Python using Sentinel Hub services.
★ 892Pythonupdated 2026-03-10awsogc-servicespython-librarysatellite-imagerysentinel-hub
Datasets for deep learning with satellite & aerial imagery
★ 1,131updated 2026-04-15datasetsearth-observationremote-sensingsatellite-datasatellite-imagery
Interactive interface for browsing global, full-resolution satellite imagery
★ 985JavaScriptupdated 2026-04-22data-visualizationearth-sciencehacktoberfestnasanasa-gibs
Python package for earth-observing satellite data processing
★ 1,182Pythonupdated 2026-04-16closemberdaskhacktoberfestpythonsatellite
Techniques for deep learning with satellite & aerial imagery
★ 10,119updated 2026-04-15convolutional-neural-networksdatasetdatasetsdeep-learningdeep-neural-networks
Collect and query ADS-B data to find aircraft and trends based on geographic region(s), altitude, bearing, aircraft type and more.
★ 67Vueupdated 2026-03-05ads-baircraftflight-trackingosint
📡 A curated list of awesome ASD-B tools, projects, images, resources and other shiny things.
★ 304HTMLupdated 2026-04-14adsbawesomeawesome-listlistresources
This is the repository for Global Geopolitical Events Database
★ 13updated 2026-04-19
A list of open-source aviation projects and data
★ 122Pythonupdated 2026-04-23aviationawesome-listosint
Global threat map. Learn wars, conflicts, military bases and history of nations.
★ 1,484TypeScriptupdated 2026-04-20aiai-agentsai-assistantintelligencenato
OSINT Tool for Finding Passwords of Compromised Email Addresses
★ 2,545Pythonupdated 2026-03-28apihacked-emailshaveibeenpwnedosintpasswords
OSINT tool to find breached emails, databases, pastes, and relevant information
★ 1,554Pythonupdated 2025-08-14breachbreachesdomainsemailsosint
Desktop app to generate 3D models from images using local AI — runs entirely on your GPU
★ 1,824TypeScriptupdated 2026-04-223dai-localai-toolsdesktop-appmodly
A self-hosted email client with an AI agent, running entirely on Cloudflare Workers
★ 1,421TypeScriptupdated 2026-04-17
One brain, many harnesses. Portable .agent/ folder (memory + skills + protocols) that plugs into Claude Code, Cursor, Windsurf, OpenCode, OpenClaw, Hermes, or DIY Python — and keeps its knowledge when you switch.
★ 1,629Pythonupdated 2026-04-23
See where Claude Code is burning tokens - turn raw JSONL transcripts into local cost analytics, hotspot views, and session-level usage insight.
★ 271Pythonupdated 2026-04-20
Uncensored, open-source alternative to Higgsfield AI, Freepik AI, Krea AI, Openart AI — Free, unrestricted AI image & video generation studio with 200+ models (Flux, Midjourney, Kling, Sora, Veo). No content filters. Self-hosted, MIT licensed.
★ 8,455JavaScriptupdated 2026-04-23ai-art-generatorai-image-generationai-video-generationcreative-toolsflux-1
Langchain Voice Agent with Inworld TTS
★ 34TypeScriptupdated 2026-04-16
Inworld API Examples
★ 58JavaScriptupdated 2026-04-15
Typst package for drawing diagrams with arrows, built on top of CeTZ.
★ 990Typstupdated 2026-04-05cetzcommutative-diagramsdiagramsflowcharttikzcd
Touying is a powerful package for creating presentation slides in Typst.
★ 2,065Typstupdated 2026-04-23presentationpresentation-slidesslidestouyingtypst
Awesome Typst Links
★ 3,400Emacs Lispupdated 2026-04-19awesomeawesome-listtypst
An integrated editor for the typst typesetting system.
★ 156Pythonupdated 2026-03-23
📑 Install Typst and add it to the PATH with package management
★ 174TypeScriptupdated 2026-03-29actioncompilergithub-actionsinstallermarkup
A local-first LaTeX & Typst web editor with real-time collaboration & offline support
★ 738TypeScriptupdated 2026-04-23bibtexdiagramminglatexlatex-editorlink-sharing
borb is a library for reading, creating and manipulating PDF files in python.
★ 3,567Pythonupdated 2026-04-19librarypdfpdf-conversionpdf-converterpdf-generation
Display paginated content in the browser and generate print books using web technology
★ 1,310HTMLupdated 2026-04-23htmlpaged-mediapdfpolyfillprinting
Resumes as code in YAML, brought to you with ❤️ by PPResume.
★ 1,354TypeScriptupdated 2026-04-23curriculum-vitaecurriculum-vitae-templatecv-buildercv-templatejson-resume
🪐 Markdown with superpowers: from ideas to papers, presentations, websites, books, and knowledge bases.
★ 10,654Kotlinupdated 2026-04-23compilerdocumentationknowledge-managementmarkdownmarkup
✉️ An awesome list of resources to build better emails.
★ 2,678updated 2024-10-03awesomeemailemail-campaignsemail-marketingemail-template
Quickly create responsive HTML emails that work on any device and client. Even Outlook.
★ 7,789HTMLupdated 2026-03-13
Manage multiple Claude Code configuration profiles. Switch between work, personal, and other accounts without logging in and out.
★ 25Shellupdated 2026-04-15anthropicclaudeclaude-codecliconfiguration
Read-only AliExpress MCP server — search, product details, shipping estimates. Uses signed MTOP API calls (mtop.js replication) with cookies from mcp-auth-bridge.
★ 2Pythonupdated 2026-04-14
Superme is a claude skill that lets you order food from shufersal online (supported now more later)
★ 28updated 2026-03-29
★ 17TypeScriptupdated 2025-06-17
Price comparison app — finds best deals across Israeli stores (Zap, KSP, Bug)
★ 1TypeScriptupdated 2026-03-23
Agent-native CLI for the morning by Green Invoice REST API — built by JangoAI
★ 7Pythonupdated 2026-04-14
Embedded single-file knowledge graph database with vector search and full-text search for AI/RAG apps
★ 5Zigupdated 2026-04-19
The SQLite for vector embeddings — A simple, embedded vector database that stores everything in a single file.
★ 81Pythonupdated 2026-03-02
:globe_with_meridians: List of all countries with names and ISO 3166-1 codes in all languages and data formats.
★ 5,247HTMLupdated 2026-04-17
Comprehensive country code information, including ISO 3166 codes, ITU dialing codes, ISO 4217 currency codes, and many others
★ 973Pythonupdated 2026-04-01
A lightweight library for normalizing speech transcripts before computing WER
★ 18Pythonupdated 2026-04-17aiasrbenchmarknormalizationspeech-to-text
Benchmarking STT service TTFB and semantic WER for real-time AI applications
★ 57Pythonupdated 2026-03-20
Plumb a PDF for detailed information about each char, rectangle, line, et cetera — and easily extract text and tables.
★ 10,173Pythonupdated 2026-01-28pdfpdf-parsingtable-extraction
Machine Readable Formats of CAMEO (Conflict and Mediation Event Observations) Event Data Codebook
★ 23Javaupdated 2019-09-19
אתר חיפוש והורדת שירים
★ 8Pythonupdated 2026-04-19downloaderisraeljewishmusicsingles
Rust in Israel
★ 4Rustupdated 2026-04-20communitycompaniesisraelrustrust-lang
Automated Israel & AI News Dashboard Public
★ 1HTMLupdated 2026-04-20
A 2026 tax year calculator for Americans considering a move to Israel (aliyah). Compares take-home income, healthcare, property tax, and Jewish day school cost across all 50 U.S. states vs Israel. Built to stay evergreen.
★ 1TypeScriptupdated 2026-04-20aliyahfinancial-calculatorisraeljewishmoving-to-israel
Multi-agent price comparison — Israel vs abroad, all in ILS
★ 1HTMLupdated 2026-04-20
BagrutAI - Smart Bagrut Exam Prep App for Israeli Students
★ 1HTMLupdated 2026-04-20
🏡 Transform real estate searches with natural language queries; find contextually relevant listings effortlessly using ML embeddings and vector search.
★ 1Pythonupdated 2026-04-20bootstrapdialogdotfile-managerdotfilesdotfiles-linux
Scrape Yad2 in Python.
★ 2Pythonupdated 2025-02-20
A Homebridge plugin for real-time civil defense alerts in Israel, integrating with HomeKit and Chromecast devices. Connects to the Tzofar WebSocket API to deliver configurable missile alerts, early warnings, and all-clear notifications with per-device time and volume controls.
★ 5JavaScriptupdated 2026-03-30israelmissileredalert
Mission to create a Hebrew TTS model as powerful and user-friendly as WaveNet
★ 40Pythonupdated 2025-01-05hebrewisraelpytorchtts
iHerb Checker - Check if supplements are prescription-only in Israel
★ 1JavaScriptupdated 2026-04-02
12-agent legal document processing pipeline — Israeli legal system. Calm timeline UI with real court documents.
★ 1HTMLupdated 2026-04-02
AI-powered Israeli law monitoring SaaS — Hebrew-first regulatory alerts for businesses
★ 1TypeScriptupdated 2026-04-03
Israeli price scraping and deal-finding system - tracks 40K+ products across 1300+ stores
★ 1Pythonupdated 2026-04-03
AI compliance framework for Israeli tech companies — EU AI Act, GDPR & Israeli Privacy Law
★ 1updated 2026-04-05ai-compliancedata-privacy-complianceeu-ai-actgdprisrael
Product deduplication pipeline for Israeli price-comparison — Hebrew/English normalization, FAISS embeddings, LLM cluster refinement. Pair F1: 0.955
★ 1Pythonupdated 2026-04-07deduplicationembeddingsfaissnlpopenai
Geopolitical early warning system for the Iran-USA-Israel crisis. Real-time event ingestion, 7 risk indices, 5 escalation scenarios with explainable alerts. FastAPI + Next.js + PostgreSQL + Celery on Railway.
★ 3TypeScriptupdated 2026-04-07celerydashboardearly-warningfastapigeopolitics
Agentic research assistant for Israeli Knesset data — LangGraph + RAG + MCP
★ 1Pythonupdated 2026-04-08
This repository contains a multi layer analysis of news articles, editorial opinions and public comments about the ongoing Iran - Israel War. It synthesis the dominant themes by perspectives by global media channels and what is convergence/divergence of editor's opinions and common public to news articles.
★ 1Jupyter Notebookupdated 2026-04-08
An R package containing Israeli baby names from Israel's Central Bureau of Statistics (LAMAS)
★ 5Pythonupdated 2026-04-08
מדד איכות קרנות פנסיה - Israeli Pension Fund Quality Index
★ 1TypeScriptupdated 2026-04-19
Portal for mental health services in Israel
★ 1HTMLupdated 2026-04-09
LinkedIn job scraper for defense/cyber industry opportunities in Israel
★ 1TypeScriptupdated 2026-04-09
Agentic Telegram bot for Home Front Command security alerts — LangGraph, 4 LangChain tools, wartime deployment
★ 3TypeScriptupdated 2026-04-10agentic-aihome-front-commandisraellangchainlanggraph
Vector Maps for the Israel Hiking and Biking Maps
★ 12updated 2026-04-10
A real-time multiplayer economic simulation game
★ 1JavaScriptupdated 2026-04-10
HACS integration that fetches Israel-related breaking news via xAI Grok API
★ 1Pythonupdated 2026-04-10home-assistantisraelnews
A Cloudflare webapp (Nuxt + Hono worker) uses Gemini API to analyze Israeli Payslips
★ 1TypeScriptupdated 2026-04-10
A python package with parsers to process the supermarkets data
★ 8Pythonupdated 2026-04-10gov-ilisraelisraeliparsersupermarket
★ 1Pythonupdated 2026-04-11
The ultimate open-source tax reporting tool for Israeli investors using Interactive Brokers. Convert IBKR Flex Queries into localized Israeli tax reports (Form 1301/Appendix G).
★ 1updated 2026-04-11
Israeli news aggregator — aggregates top articles from Ynet, N12, Israel Hayom and C14, clusters similar topics together
★ 1TypeScriptupdated 2026-04-11
Personal finance tracker for Israeli banks and credit cards, built as an Electron desktop app.
★ 3TypeScriptupdated 2026-04-20electronisraeli-bankspersonal-financereactvite
Israel Business Tax Dashboard - VAT and Income Tax calculations with Green Invoice integration
★ 1HTMLupdated 2026-04-12
CLI tool for aggregating financial data from Israeli brokers, pension funds, and credit cards. Automated web scraping with MFA support and SQLite storage.
★ 1Pythonupdated 2026-04-12
Claude Code plugin: Search Israeli real estate platforms for rental apartments with Telegram notifications
★ 1JavaScriptupdated 2026-04-13
Watch Israeli TV channels live on Android. A simple, fast, and modern app for Israeli IPTV with PiP support and favorites. Built with Jetpack Compose.
★ 1Kotlinupdated 2026-04-13androidexoplayeriptv-playerisrael-tvjetpack-compose
Automatically import transactions from 18 Israeli banks and credit cards into Actual Budget
★ 3TypeScriptupdated 2026-04-20actual-budgetautomationbank-scraperbudgetingcamoufox
HomeAI Israel Investment Finder — Real-time investment analysis platform for Israeli cities, powered by government open data
★ 2TypeScriptupdated 2026-04-14
Israeli personal finance PDF analyzer — AI-powered
★ 1HTMLupdated 2026-04-14
CLI tool for scraping Israeli bank transactions and exporting to YNAB-compatible CSV, with audit logging and reconciliation
★ 1TypeScriptupdated 2026-04-15
The Israeli BBQ Master — Smart grill manager for Yo Ha'atzmaut. Next.js + TypeScript + Tailwind CSS.
★ 1updated 2026-04-15
AI Recommendation Platform for Israeli Small Businesses - Get recommended by ChatGPT and Perplexity
★ 1TypeScriptupdated 2026-04-16
AI Agent for בדיקת התכנות נחלות - Feasibility Studies for Israeli Agricultural Settlements
★ 1Pythonupdated 2026-04-16
CLI tool for tracking finances from Israeli banks and credit cards (כל שקל)
★ 12TypeScriptupdated 2026-04-16
Win-odds calculator for Israel's subsidized housing lottery (Mehir LeMishtaken) — pick eligibility category and up to 3 cities, get probability estimates.
★ 1HTMLupdated 2026-04-17
Interactive data visualisation of 142,837 rocket, missile & drone alerts across Israel (2020–2026)
★ 1HTMLupdated 2026-04-17
A model of Israel's tax-benefit system.
★ 1Pythonupdated 2026-04-17
Shiftly is a modern and intuitive work-hour tracking system designed to calculate salaries according to Israeli labor laws. It handles complex wage structures including overtime, night bonuses, and special weekend/holiday rates.
★ 1TypeScriptupdated 2026-04-18hebrew-calendarisraellabor-lawmaterial-uipayroll
Scrapes Israeli government portal (gov.il) collector pages via internal JSON APIs. Flask dashboard, CSV/Excel export, file attachment downloads.
★ 1Pythonupdated 2026-04-18flaskgovernmentisraelopen-datapython
Home Assistant custom integration for Israeli Mashov education system
★ 6Pythonupdated 2026-04-18automation-blueprintcustom-componenthacshome-assistanthomeassistant
Extract structured job listings from drushim.co.il, Israel's leading job board. Search by keyword, location, category, experience level, and job type. Get full descriptions, salary data, company info, and geo-coordinates.
★ 1updated 2026-04-18
Parse and filter NOTAM in Israel
★ 1TypeScriptupdated 2026-04-20
Telegram bot: 2 daily Peninei Halacha voice recordings at 5AM Israel time 📖
★ 1JavaScriptupdated 2026-04-20
AI Pulse Israel - Hebrew AI News Portal with Daily Automation
★ 1TypeScriptupdated 2026-04-20
★ 1Pythonupdated 2026-04-19
Pure client side, Google Sheets backed, Portfolio management tool with taxation and Israeli market support
★ 1TypeScriptupdated 2026-04-20
Israeli Customs Intelligence Platform - AI-powered document classification, email monitoring, and self-learning knowledge base
★ 1Pythonupdated 2026-04-20
A live index of open roles in Israeli hi-tech. Filter by city, company, title, seniority, or industry - all in your browser.
★ 2HTMLupdated 2026-04-20
Personal trading intelligence platform — Israeli (TASE) and US equities via IBI, with Claude-powered AI chat agent
★ 2TypeScriptupdated 2026-04-19
★ 1updated 2026-04-20
Israeli parliament (Knesset) data platform — OData ingestion, DuckDB warehouse, Streamlit UI for research analysis.
★ 1Pythonupdated 2026-04-20data-analysisduckdbisraelknessetodata
A tool for visualization and analysis of Home Front Command alerts distributed in Israel starting from the beginning of the Lion's Roar Operation
★ 1JavaScriptupdated 2026-04-19
Automatically save transactions from all major Israeli banks and credit card companies, using GitHub actions (or a self hosted docker image)
★ 93TypeScriptupdated 2026-04-20financescrapingtelegram
A python package with client to scrape the israeli supermarkets data
★ 34Jupyter Notebookupdated 2026-04-08israelisraeliscraperscrapingsupermarket
Parser & Tagger for Israeli laws documents
★ 2Pythonupdated 2022-10-06docdocumentsisraeli-lawparserpdf
Israel law - Privacy Protection Law, Cyber Directorate regulations, Companies Law with HE/EN search
★ 2TypeScriptupdated 2026-04-16
Israel law - Privacy Protection Law, Cyber Directorate regulations, Companies Law with HE/EN search
★ 1updated 2026-04-08
Tactics2D: A Reinforcement Learning Environment Library with Generative Scenarios for Driving Decision-making
★ 272Pythonupdated 2026-04-15autonomous-drivinggym-environmentpython3reinforcement-learningsimulator
A Python-based toolbox of various methods in decision making, uncertainty quantification and statistical emulation: multi-fidelity, experimental design, Bayesian optimisation, Bayesian quadrature, etc.
★ 655Pythonupdated 2026-02-22bayesian-optimizationbayesian-quadraturedecision-makingemulationexperimental-design
ALICE (Automated Learning and Intelligence for Causation and Economics) is a Microsoft Research project aimed at applying Artificial Intelligence concepts to economic decision making. One of its goals is to build a toolkit that combines state-of-the-art machine learning techniques with econometrics in order to bring automation to complex causal inference problems. To date, the ALICE Python SDK (econml) implements orthogonal machine learning algorithms such as the double machine learning work of Chernozhukov et al. This toolkit is designed to measure the causal effect of some treatment variable(s) t on an outcome variable y, controlling for a set of features x.
★ 4,610Jupyter Notebookupdated 2026-04-13causal-inferencecausalityeconometricseconomicsmachine-learning
FinceptTerminal is a modern finance application offering advanced market analytics, investment research, and economic data tools, designed for interactive exploration and data-driven decision-making in a user-friendly environment.
★ 15,037Pythonupdated 2026-04-20ai-agentsalgorithmic-tradingbloomberg-terminalcppfinance
Multi-AI consensus MCP server that queries multiple AI models (OpenAI, Claude, Gemini, custom APIs) in parallel and synthesizes responses to reduce bias and improve accuracy. A Python implementation of the wisdom-of-crowds approach for AI decision making.
★ 23Pythonupdated 2025-06-26ai-consensusai-synthesisai-toolclaudeclaude-desktop
A sophisticated Model Context Protocol (MCP) server for analyzing Architectural Decision Records (ADRs) and providing deep architectural insights to AI agents.
★ 28TypeScriptupdated 2026-04-20adrai-agentsarchitectural-decision-recordsarchitectureclaude
Thoughtbox is an intention ledger for agents. Evaluate AI's decisions against its decision-making.
★ 56TypeScriptupdated 2026-04-20ai-agentsclaudeclaude-codeclaudecodemcp
AI-native macro investment research infrastructure with native MCP, terminal CLI, agent runtime, and disciplined decision workflows. 一个 AI-native 的宏观投资研究基础设施,内建原生 MCP、Terminal CLI、Agent Runtime 与纪律化决策工作流。
★ 65Pythonupdated 2026-04-20ai-nativemacro-analysispersonal-agentpersonal-finance-agentresearch-infrastructure
An MCP server for Massive.com Financial Market Data
★ 308Pythonupdated 2026-04-17cryptocurrencyfintechllmmarket-datamcp
Open-source FRED MCP Server (Federal Reserve Economic Data)
★ 84TypeScriptupdated 2026-03-22datadata-analysis-projectfinancefinancial-analysisgenai
Technical indicators to run technical analysis with JavaScript & TypeScript. 📈
★ 907TypeScriptupdated 2026-04-20analysiscryptotradingdemadmaema
ATLAS by General Intelligence Capital — Self-improving AI trading agents using Karpathy-style autoresearch
★ 1,368Pythonupdated 2026-03-20
A collection of skills for AI financial analysis and trading.
★ 1,296TypeScriptupdated 2026-04-16agent-skillsclaude-codeskillstrading
News Aggregation · AI Ratings · Trading Signals · Real-time Updates
★ 1,068Pythonupdated 2026-04-10
Real-time crypto & stock screening, advanced technical indicators, Bollinger Bands intelligence, candlestick patterns + native Claude Desktop integration. Multi-exchange (Binance, KuCoin, Bybit+). Open-source AI trading infrastructure.
★ 2,173Pythonupdated 2026-04-14claude-desktopcryptocurrencymcp-servermcp-toolsopenclaw
Algorithmic Trading in Python with Machine Learning
★ 3,274Pythonupdated 2026-04-20aialgorithmic-tradingalgotradingartificial-intelligencebacktesting
AI-based stock analysis and trading system
★ 558Pythonupdated 2026-04-15aillmmcpmulti-agentstock
Your one-person Wall Street. An AI trading agent covering equities, crypto, commodities, forex, and macro — from research through position entry, ongoing management, to exit.
★ 3,746TypeScriptupdated 2026-04-20
AI-assisted TradingView chart analysis — connect Claude Code to your TradingView Desktop for personal workflow automation
★ 2,335JavaScriptupdated 2026-04-04
FinRL-X: An AI-Native Modular Infrastructure for Quantitative Trading
★ 3,053Pythonupdated 2026-04-19a2c-algorithmautomated-stock-tradingddpgdeep-reinforcement-learningensemble-strategy
Your personal AI trading assistant. Any market. Any model. Pay with USDC, not API keys.
★ 12,032Goupdated 2026-04-19agentictradingaiai-tradingarbitragebinance
ffn - a financial function library for Python
★ 2,536Pythonupdated 2026-03-21
Kronos: A Foundation Model for the Language of Financial Markets
★ 21,511Pythonupdated 2026-04-13
An autonomous agent for deep financial research
★ 21,483TypeScriptupdated 2026-04-16
FinRL®: Financial Reinforcement Learning. 🔥
★ 14,920Jupyter Notebookupdated 2026-04-05algorithmic-tradingdeep-reinforcement-learningdrl-algorithmsdrl-frameworkdrl-trading-agents
★ 7,770Pythonupdated 2026-04-17
A curated list of practical financial machine learning tools and applications.
★ 8,530Pythonupdated 2025-01-03algorithmic-tradingcryptocurrencyfinanceinvestmentquant
Open-source, cloud-native ledger platform for building financial infrastructure — multi-currency, multi-asset, double-entry accounting with n:n transaction support.
★ 374Goupdated 2026-04-17accountingcloud-nativecore-bankingcqrsdouble-entry-accounting
FinnewsHunter: Multi-agent financial intelligence platform powered by AgenticX. Real-time news analysis, sentiment fusion, and alpha factor mining.
★ 1,409Pythonupdated 2026-01-13agentic-aialpha-signalsfintechmulti-agentquant-finance
💹 StockSim: Multi-Agent LLM Financial Market Simulator — A realistic trading simulation platform for evaluating large language models in dynamic financial environments.
★ 25Pythonupdated 2025-07-15algorithmic-tradinganthropicasyncbacktestingdocker
AlphaSuite is an open-source quantitative analysis platform that gives you the power to build, test, and deploy professional-grade trading strategies. It's designed for traders and analysts who want to move beyond simple backtests and develop a genuine, data-driven edge in the financial markets.
★ 213Pythonupdated 2026-03-03algorithmic-tradingbacktestingdata-analysisfintechlangchain
Open-source AI-driven quantitative trading platform for crypto, stocks, and forex with backtesting, live trading, market data, and multi-agent research.
★ 2,135Pythonupdated 2026-04-20ai-traderalgorithmic-trading-portfolioalgotradebacktesting-frameworkscryptocurrencies
Python toolkit for quantitative finance
★ 10,146Jupyter Notebookupdated 2026-04-17derivativesgoldman-sachsgs-quantrisk-managementtrading-strategies
Portfolio analytics for quants, written in Python
★ 7,029Pythonupdated 2026-01-13algo-tradingalgorithmic-tradingalgotradingfinanceplotting
modular quant framework.
★ 4,112Pythonupdated 2026-04-13algorithmic-tradingbacktestingcryptocurrencyfintechfundamental-analysis
Financial markets analysis framework for programmers
★ 1,091Pythonupdated 2026-04-13
Transparent and Efficient Financial Analysis
★ 4,641Pythonupdated 2026-04-14commoditieseconomicsequitiesfactor-analysisfinance
Microsoft Finance Time Series Forecasting Framework (FinnTS) is a forecasting package that utilizes cutting-edge time series forecasting and parallelization on the cloud to produce accurate forecasts for financial data.
★ 254Rupdated 2026-04-20agentaibusinessfeature-selectionfinance
Open Financial API of Realtime Financial Data including Stock Price Quote, Major Index from Global Market, Options to Build Financial AI Agents.
★ 24Pythonupdated 2026-03-30agentsstock
TimeGPT-1: production ready pre-trained Time Series Foundation Model for forecasting and anomaly detection. Generative pretrained transformer for time series trained on over 100B data points. It's capable of accurately predicting various domains such as retail, electricity, finance, and IoT with just a few lines of code 🚀.
★ 3,861Jupyter Notebookupdated 2026-04-13agentagentic-aianomaly-detectionartificial-intelligencedeep-learning
Qlib is an AI-oriented Quant investment platform that aims to use AI tech to empower Quant Research, from exploring ideas to implementing productions. Qlib supports diverse ML modeling paradigms, including supervised learning, market dynamics modeling, and RL, and is now equipped with https://github.com/microsoft/RD-Agent to automate R&D process.
★ 41,260Pythonupdated 2026-04-17algorithmic-tradingauto-quantdeep-learningfinancefintech
Build your autonomous hedge fund in minutes. AutoHedge harnesses the power of swarm intelligence and AI agents to automate market analysis, risk management, and trade execution.
★ 1,531Pythonupdated 2026-04-13aiblackrockfinancegoldmansachshedgefund
Clarity is a financial analysis agent framework built on native Claude-skill architecture. Adopting a Planning-with-Files approach, it coordinates specialized sub-agents via persistent task plans, research findings, and progress logs to tackle complex financial analysis workflows.
★ 54Pythonupdated 2026-01-27
The Yahoo Finance Agent is an application that combines OpenAI's LLMs, the Yahoo Finance Python library, and LangChain's tools to provide real-time financial data. It features stock information, financial statements, and an interactive chat interface, all while maintaining conversation context and integrating with Langsmith for debugging
★ 28HTMLupdated 2024-08-10langchainlangsmithopenaiopenai-fupython
FinRobot: An Open-Source AI Agent Platform for Financial Analysis using LLMs 🚀 🚀 🚀
★ 6,777Jupyter Notebookupdated 2026-04-03aiagentchatgptfinancefingptlarge-language-models
ValueCell is a community-driven, multi-agent platform for financial applications.
★ 10,424Pythonupdated 2026-03-09agentic-aiagentsaiassitantcrypto
CLI-first banking for agents
★ 219TypeScriptupdated 2026-04-03aifinance
Claude Code for Finance
★ 950Pythonupdated 2026-04-20agentinvestmentlangchainlangraphllm
A collection of Awesome Finance Agent Skills for free and easy to start | 一系列开源免费的金融分析Agent Skills
★ 1,910Pythonupdated 2026-03-29agentagent-skillsfinancesfintech
A currency conversion MCP server
★ 35TypeScriptupdated 2025-06-23
AI-powered music production in REAPER via the Model Context Protocol — 163 tools for composition, MIDI, FX, mixing, and mastering.
★ 3Pythonupdated 2026-04-17anthropicaudioclaudecompositiondaw
[ECCV 2024] Official implementation of the paper "Grounding DINO: Marrying DINO with Grounded Pre-Training for Open-Set Object Detection"
★ 10,045Pythonupdated 2024-08-12object-detectionopen-worldopen-world-detectionvision-languagevision-language-transformer
🤖 AI-powered ADR generation - Automatically capture and document architectural decisions as you code
★ 13TypeScriptupdated 2026-04-16adrarchitectural-decision-recordscicdcoding-agentscontinues-ai
CubiCasa5k floor plan dataset
★ 494Jupyter Notebookupdated 2026-02-10datasetdataset-cubicasa5kfloorplan-image
The project uses a computer vision model to extract structured features from floor plan images for a fire risk assessment.
★ 80Pythonupdated 2024-07-08deep-learningdeep-neural-networksdjangodjango-applicationfloorplan
★ 398Pythonupdated 2024-02-01
Live GCC missile tracker monitoring Iranian attacks on UAE, Qatar, Kuwait & Bahrain. Interactive charts, theatre map with impact sites, interception rates, arsenal analysis, and daily breakdowns. Auto-updated from official Ministry of Defence sources.
★ 6JavaScriptupdated 2026-04-20
Keep passwords and other sensitive information out of your inboxes and chat logs.
★ 2,767Rubyupdated 2026-04-18chatemailmessagingonetimeonetimesecret
📄 A command line tool to generate PDF from URL, HTML or Markdown files.
★ 1,293JavaScriptupdated 2026-02-12
Advanced news feeds extractor and finder library. Helps to automatically extract news from websites without RSS/ATOM feeds
★ 83Pythonupdated 2025-11-26newsnews-scraperpythonrssrss-feed-parser
Advanced feed autodiscovery for JavaScript. Collect feeds, hubs, and blogrolls from any webpage using multiple discovery methods.
★ 8TypeScriptupdated 2026-04-17blogrollfeed-autodiscoveryfeed-finderopmlrss
📰 RSS Feed Integration
★ 179Pythonupdated 2026-04-07feedparserhome-assistanthome-assistant-componenthome-assistant-hacshome-assistant-sensor
ArtifactFS is a filesystem driver designed to mount large git repos as quickly as possible, hydrating file contents on-the-fly instead of blocking on the initial clone. It's ideal for agents, sandboxes, containers and other use-cases where startup time is critical.
★ 736Goupdated 2026-04-16cloudflarefilesystemfusegit
A curated list of insanely awesome libraries, packages and resources for Quants (Quantitative Finance)
★ 25,813HTMLupdated 2026-04-20algorithmic-trading-enginealgorithmic-trading-libraryalgotradingarbitrage-botawesome
An open source template for building cloud agents.
★ 4,132TypeScriptupdated 2026-04-20agentagentsaibackground-agents
Self-hosted audiobook and podcast server
★ 12,565JavaScriptupdated 2026-04-19audiobook-manageraudiobooksaudiobookshelfpodcastsself-hosted
Local realtime transcription tool powered by Voxtral Mini
★ 5Swiftupdated 2026-02-23
Pure C inference of Mistral Voxtral Realtime 4B speech to text model
★ 1,627Cupdated 2026-02-15
High-Quality Voice Cloning TTS for 600+ Languages
★ 4,292Pythonupdated 2026-04-20
Write HTML. Render video. Built for agents.
★ 10,875TypeScriptupdated 2026-04-20aianimationffmpegframeworkgsap
🦞An Israeli consumer discount skill that maps any store to its best card, club, or voucher deal — covering HTZone, Poalim Wonder, and government price data across 72 stores and 14 categories
★ 1Pythonupdated 2026-03-27clawhubconsumercouponscredit-cardsdeals
OpenRouter skill for AI agents: model discovery, multimodal chat, tool calling, routing, and starter templates.
★ 12TypeScriptupdated 2026-03-05agent-skillai-agentsexpressllm-toolsmultimodal
Skill that audits and rewrites content to remove AI writing patterns. Use it with your favorite agents including Claude Code, OpenClaw, and Hermes.
★ 1,223updated 2026-04-18ai-writingclaudeclaude-codellmprompt-engineering
An open source GitHub Android client app, faster and concise.
★ 4,359Javaupdated 2024-05-30android-clientgithubgithub-androidgithub-clientopenhub
AI-powered bug bounty hunting from your terminal - recon, 20 vuln classes, autonomous hunting, and report generation. All inside Claude Code.
★ 1,877Pythonupdated 2026-04-18ai-securitybug-bountybugcrowdclaude-aiclaude-code
An interactive git visualization and tutorial. Aspiring students of git can use this app to educate and challenge themselves towards mastery of git!
★ 33,381JavaScriptupdated 2026-04-09
Curated list of project-based tutorials
★ 264,106updated 2024-08-15beginner-projectcppgolangjavascriptproject
Learn regex the easy way
★ 46,136updated 2025-08-25learn-regexregexregular-expression
A collection of tech resources that allow you to learn new things by playing games
★ 864updated 2025-08-11awesomeawesome-listcodingfreegame
A curated list of games that can teach you how to learn a programming language.
★ 2,093updated 2026-03-25awesomeawesome-listgameguido-van-robotprogramming-language
A curated list of awesome remote jobs and resources. Inspired by https://github.com/vinta/awesome-python
★ 45,406updated 2026-01-12awesomeawesome-listlist
🔥 Awesome list of resources on Web Development.
★ 5,723updated 2025-07-16aiawesome-listcssdeveloper-storiesjavascript
Blueprint by Mozilla.ai for generating podcasts from documents using local AI
★ 175Pythonupdated 2026-04-13local-aipodcasttext-to-speechtext-to-text
AI-powered CLI tool to automatically organize your GitHub Stars into Lists.
★ 51TypeScriptupdated 2026-02-03automationbunclicurationdeveloper-tools
Star Manager is a local-first web app for organizing GitHub starred repositories with Star Lists and optional LLM-assisted classification.
★ 12TypeScriptupdated 2026-03-26
Automatically categorize your GitHub starred repos into Star Lists using LLM.
★ 21Pythonupdated 2026-03-08github
One webpage for every book ever published!
★ 6,379Pythonupdated 2026-04-18bookshacktoberfestinternet-archivelibrary-catalogueopen-source
Generate beautiful dark-themed system architecture diagrams as standalone HTML/SVG files. Works as a Claude AI skill.
★ 4,408HTMLupdated 2025-12-22
X Intelligence CLI — search, monitor, analyze, and engage on X/Twitter. TypeScript + Bun. AI agent skill. Using xAPI & xAI api keys
★ 122TypeScriptupdated 2026-04-15ai-agentsbunclaudecliopenclaw
Open source comprehensive 2D content creation tool suite for graphic design, digital art, and interactive real-time motion graphics — featuring node-based procedural editing
★ 25,305Rustupdated 2026-04-202d-graphicsanimationartcreative-codingdesign
AI-powered job search system built on Claude Code. 14 skill modes, Go dashboard, PDF generation, batch processing.
★ 39,726JavaScriptupdated 2026-04-19ai-agentanthropicautomationcareerclaude
API client for electra air conditioner models that support the ElectraSmart app
★ 18Pythonupdated 2022-12-18
Open-source economic impact tracker for the 2026 US-Israel-Iran conflict. Oil prices, inflation, household costs across 29 economies. Updated daily.
★ 2HTMLupdated 2026-04-20
The official Pinecone marketplace for Claude Code Plugins
★ 57Pythonupdated 2026-03-06anthropic-claudeclaude-codeclaude-code-pluginclaude-code-plugin-marketplacehybrid-search
MineContext is your proactive context-aware AI partner(Context-Engineering+ChatGPT Pulse)
★ 5,288Pythonupdated 2026-03-12agentcontext-engineeringelectronembedding-modelsjavascript
An Obsidian vault that gives AI coding agents persistent memory. Claude Code, Codex CLI, Gemini CLI.
★ 2,061TypeScriptupdated 2026-04-19
Universal memory layer for AI Agents. It provides scalable, extensible, and interoperable memory storage and retrieval to streamline AI agent state management for next-generation autonomous systems.
★ 3,535Pythonupdated 2026-04-17agentagentic-aiagentsagents-sdkai
Official community hub for Traycer — an AI-driven code analysis tool that provides live feedback inside the IDE
★ 171updated 2026-02-06
Generate text, images, video, speech, and music by MiniMax.
★ 1,578TypeScriptupdated 2026-04-20ai
Official MiniMax Model Context Protocol (MCP) server that enables interaction with powerful Text to Speech, image generation and video generation APIs.
★ 1,443Pythonupdated 2026-04-15image-generationimage-to-videomcpmcp-servermcp-tools
An agent skill that guide AI agents to write Typst
★ 97Typstupdated 2026-04-15
Typst skill for agents.
★ 62Pythonupdated 2026-04-20
A Claude Code framework for multi-llm planning and development agents
★ 44Pythonupdated 2026-04-10
[EMNLP 2025 Oral] MemoryOS is designed to provide a memory operating system for personalized AI agents.
★ 1,343Pythonupdated 2026-03-24agentlanguage-modelllmlong-term-memoryoperating-system
The best-benchmarked open-source AI memory system. And it's free.
★ 49,688Pythonupdated 2026-04-19aichromadbllmmcpmemory
MemoryBear Equip AI with human-like memory capability
★ 3,133Pythonupdated 2026-04-20
🐻 Bear necessities for state management in React
★ 57,854TypeScriptupdated 2026-04-14hacktoberfesthooksreactreact-contextreactjs
AI-powered Design Authority — 5 specialist agents evaluate architecture decisions and deliver structured rulings in under 60 seconds
★ 7Pythonupdated 2026-02-23adraiarchitecturecrewaidesign-authority
A skill to claude code that enables brainstorming with other LLMs (ChatGPT, Gemini) before presenting the implementation plan to the user
★ 51Pythonupdated 2026-01-08claude-code-skillclaude-code-skillsclaude-skills
AI agent skills for professional document generation (DOCX, PDF, XLSX) extracted from Kimi. Designer-quality outputs with native charts, validation pipelines, and full OpenXML control
★ 140JavaScriptupdated 2026-03-28
KRunner plugin for quickly opening recent VSCode workspaces
★ 30Dartupdated 2026-02-24kdekrunnervscode
n³ The unorthodox terminal file manager
★ 21,515Cupdated 2026-04-19androidbatch-renamecclicommand-line
Pretty fancy and modern terminal file manager
★ 17,212Goupdated 2026-04-18bubbleteaclifile-managerfilemanagerfilesystem
Terminal file manager
★ 9,231Goupdated 2026-04-16file-managerterminal
💥 Blazing fast terminal file manager written in Rust, based on async I/O.
★ 37,057Rustupdated 2026-04-19androidasyncioclicommand-lineconcurrency
A collection of modern/faster/saner alternatives to common unix commands.
★ 32,898updated 2024-09-10clicommand-linelistsshellterminal
Open Brain — The infrastructure layer for your thinking. One database, one AI gateway, one chat channel — any AI plugs in. No middleware, no SaaS.
★ 2,057TypeScriptupdated 2026-04-18ai-agentsmcpmemory-layermemory-layer-for-aiopen-brain
An open-source Agent-first Identity and Access Management (IAM) /LLM MCP & agent gateway and auth server with web UI supporting OpenClaw, MCP, OAuth, OIDC, SAML, CAS, LDAP, SCIM, WebAuthn, TOTP, MFA, Face ID, Google Workspace, Azure AD
★ 13,483Goupdated 2026-04-20agentagentic-aiagiai-gatewayauth
This repository aims to map the ecosystem of artificial intelligence guidelines, principles, codes of ethics, standards, regulation and beyond.
★ 1,428updated 2026-04-18aiai-ethicsai-guidelinesai-policydata-ethics
A curated list of materials on AI guardrails
★ 52Pythonupdated 2025-06-03awesomedeepfake-detectiongenaiguardrailsinappropriate-content
Orchestra is a human-in-the-loop AI system for orchestrating project teams of experts and machines.
★ 705Pythonupdated 2026-04-15experthuman-computer-interactionhuman-in-the-loop-machine-learningorchestraworkflow
📥 An inbox UX for interacting with human-in-the-loop agents.
★ 975TypeScriptupdated 2026-04-20
Full computer-use for AI agents. Self-learning workflows. Native macOS. No screenshots required.
★ 1,410Swiftupdated 2026-03-23accessibilityai-agentsautomationclaude-codecomputer-use
Open Source Semantic Search for your AI Agent
★ 1,132TypeScriptupdated 2026-01-17colbertembeddingsgrepgrep-search
Claude Code skill implementing Manus-style persistent markdown planning — the workflow pattern behind the $2B acquisition.
★ 19,626Pythonupdated 2026-04-17adalagent-skillsantigravityclaudeclaude-code
Context Gateway is an agentic proxy that enhances any AI agent workflow with instant history compaction and context optimization tools
★ 592Goupdated 2026-04-14
Context window optimization for AI coding agents. Sandboxes tool output, 98% reduction. 14 platforms
★ 10,172TypeScriptupdated 2026-04-20antigravityclaudeclaude-codeclaude-code-hooksclaude-code-plugins
A library of reinforcement learning components and agents
★ 3,974Pythonupdated 2026-04-08agentsreinforcement-learningresearch
An Open-Ended Embodied Agent with Large Language Models
★ 6,853JavaScriptupdated 2024-04-03embodied-learninglarge-language-modelsminecraftopen-ended-learning
The agent-native LLM router for OpenClaw. 41+ models, <1ms routing, USDC payments on Base & Solana via x402.
★ 6,292TypeScriptupdated 2026-04-25aiai-agentsanthropiccost-optimizationdeepseek
Easily switch between alternative low-cost AI models in Claude Code/Agent SDK. For those comfortable using Claude agents and commands, it lets you take what you've created and deploy fully hosted agents for real business purposes. Use Claude Code to get the agent working, then deploy it in your favorite cloud.
★ 655TypeScriptupdated 2026-03-26agentsclaudeclaude-agent-sdkclaude-codegemini
Deeplake is AI Data Runtime for Agents. It provides serverless postgres with a multimodal datalake, enabling scalable retrieval and training.
★ 9,100C++updated 2026-02-16agentagentic-ragaiclawbotcomputer-vision
State of the Art 82% OSWorld Verified Computer Using Agent, fully open-source, safe, auditable, and production-ready.
★ 529TypeScriptupdated 2026-04-17agentagentic-frameworkaiai-agentsanthropic
Fara-7B: An Efficient Agentic Model for Computer Use
★ 4,987Pythonupdated 2026-04-20agentbrowser-usecomputer-usecomputer-use-agentcua
A portable open-source operating system for agents. ~6 ms coldstarts, 32x cheaper than sandboxes. Powered by WebAssembly and V8 isolates.
★ 2,734Rustupdated 2026-04-14agentaijavascriptllmsandbox
Ralph is an autonomous AI agent loop that runs repeatedly until all PRD items are complete.
★ 17,826TypeScriptupdated 2026-02-02
Design circuit boards with code! ✨ Get software-like design reuse 🚀, validation, version control and collaboration in hardware; starting with electronics ⚡️
★ 3,189Pythonupdated 2026-04-03agentaicadedaelectronics
A lightweight Python framework for Parallel AI Reasoning.
★ 317Pythonupdated 2026-04-25agentic-workflowaiagentsdecision-makinglangchainlanguage-model
🏛️ 三省六部制 · OpenClaw Multi-Agent Orchestration System — 9 specialized AI agents with real-time dashboard, model config, and full audit trails
★ 15,460Pythonupdated 2026-04-19ai-agentsai-orchestrationautonomous-agentsclaudedashboard
A single interface to use and evaluate different agent frameworks
★ 1,156Pythonupdated 2026-04-15a2aagent-evaluationagentsaimcp
Samurai-inspired multi-agent system for Claude Code. Orchestrate parallel AI tasks via tmux with shogun → karo → ashigaru hierarchy.
★ 1,237Shellupdated 2026-04-19ai-agentanthropicautomationclaude-codellm
Bub it. Build it. A hook-first runtime for agents that live alongside people.
★ 1,287Pythonupdated 2026-04-20agentagentsaiai-agentsaiagentframework
A holistic framework to enable the design, development, and evaluation of autonomous AIOps agents.
★ 862Pythonupdated 2026-04-16
Get your repo ready for AI.
★ 811TypeScriptupdated 2026-04-20
AI Agent Orchestrator with Skills System - Give AI Agents superpowers: memory search, code graph queries, agent-to-agent messaging. Manage Claude, Codex or any AI Agent from one dashboard. Move Agents between computers and locations
★ 639TypeScriptupdated 2026-04-18agent-communicationagent-skillsagentic-aiai-agentsai-coding-assistant
A.S.E (AICGSecEval) is a repository-level AI-generated code security evaluation benchmark developed by Tencent Wukong Code Security Team.
★ 963Pythonupdated 2026-04-15agentaigcbenchmarkcodesecurityllm
162 production-ready AI agent templates for OpenClaw. SOUL.md configs across 19 categories. Submit yours!
★ 3,104HTMLupdated 2026-04-13ai-agent-templatesai-agentsai-automationanthropicautomation
Shell Superpowers for AI Agents.
★ 4,322Awkupdated 2026-04-18agentaibashclicloud
Open Vision Agents by Stream. Build voice and vision agents quickly with any model or video provider. Uses Stream's edge network for ultra-low latency.
★ 7,688Pythonupdated 2026-04-17agentic-aiagentsaiai-agentsrealtime
The absolute trainer to light up AI agents.
★ 17,028Pythonupdated 2026-04-03agentagentic-aillmmlopsreinforcement-learning
The open agent skills tool - npx skills
★ 2TypeScriptupdated 2026-04-19
Search Jerusalem specialty coffee shops by name, amenities, ratings, and opening hours. Agent Skills format for OpenClaw, Claude, Cursor.
★ 1Pythonupdated 2026-02-26agent-skillsai-toolsclaude-codecoffeecursor
Claude skills for Israeli health services - pharmacy, healthcare, medical
★ 1Pythonupdated 2026-04-20
Marketing & Growth skills for the Israeli market
★ 3Pythonupdated 2026-04-20
AI agent skills for SMS, email, and customer communication in Israel
★ 2Pythonupdated 2026-04-20
AI agent development utilities with Israeli adaptations
★ 5Pythonupdated 2026-04-20
A repository for an optimal placement of roadside shelters in Israel to protect citizens against ballistic missile attack
★ 1HTMLupdated 2026-04-09
Professional financial analysis tools for the Israeli stock market (TASE) — Claude Code plugin
★ 1updated 2026-03-22
Claude Code skill for the iCount accounting API — for Israeli businesses
★ 1Pythonupdated 2026-03-24
Search Israeli restaurants, check availability across date ranges, and get booking links. Agent Skills format for OpenClaw, Claude, Cursor.
★ 3Pythonupdated 2026-03-13agent-skillsai-toolsclaude-codecursorisrael
Claude skills for Israeli food, dining, and restaurant services
★ 1Pythonupdated 2026-04-20
AI-powered Israeli invoice data extractor using Claude vision
★ 1Pythonupdated 2026-03-21
Israeli career forecast for hightech industry using LLM forecasting via claude code.
★ 1HTMLupdated 2025-09-24
🕒 Chrony NTP Server running in a Docker container (without the priviledged flag)
★ 435Shellupdated 2025-03-16alpine-linuxchronychronyddockerntp
The full and complete NTP Reference Implementation from the Network Time Protocol Project at Network Time Foundation.
★ 187Cupdated 2024-12-28
Connect to a NTP server
★ 597C++updated 2026-03-17
专为Giffgaff和Simyo用户设计的eSIM管理工具集,支持完整的eSIM申请、设备更换和二维码生成流程。(A modern eSIM management toolkit designed specifically for Giffgaff and Simyo users, supporting the complete eSIM application, activation, and QR code generation process.)
★ 427JavaScriptupdated 2026-04-19esimgiffgaffsimyotools
Mirror of OpenEUICC, a fully open-source LPA implementation for Android
★ 697Kotlinupdated 2026-04-17
A light-weight and powerful meta-prompting, context engineering and spec-driven development system for Claude Code by TÂCHES.
★ 57,400JavaScriptupdated 2026-04-20claude-codecontext-engineeringmeta-promptingspec-driven-development
TypeScript multi-agent orchestration engine — one runTeam() call from goal to result. Multi-model teams, auto task decomposition, parallel execution. 3 runtime dependencies.
★ 5,904TypeScriptupdated 2026-04-20agent-frameworkai-agentsanthropicclaudedeepseek
★ 79MDXupdated 2026-03-15
Claude Code skills and hooks for staying organized with AI agents.
★ 55Pythonupdated 2026-03-01adhdclaude-codeobsidianproductivityskills
Built by a PhD whose memory was failing, whose diet was a mess, and whose anxiety had its own agenda. Most second brain tools ignore the fact that your brain doesn't work in isolation: your body and your mental health are part of the system too. This crew handles all three: knowledge, nutrition, and mental wellness.
★ 2,944Shellupdated 2026-04-12
Unofficial MCP server for Make.com build, validate & deploy automation scenarios with AI. 200+ modules, auto-healing blueprints, router support. Community project, not affiliated with Make.com.
★ 3TypeScriptupdated 2026-04-06
Ceph is a distributed object, block, and file storage platform
★ 16,508C++updated 2026-04-20block-storagecloud-storagedistributed-file-systemdistributed-storageerasure-coding
Local AI assistant, dreaming explorable worlds.
★ 1,097Rustupdated 2026-04-19agentaibevyrustworld
Check prescription medication stock at Maccabi pharmacies before you go. Search all nearby branches in one query. Agent Skills format.
★ 2JavaScriptupdated 2026-02-21agent-skillsai-toolsclaude-codecursorhealthcare
A Cowork skill for checking real-time stock availability at Super-Pharm branches in Israel 🇮🇱
★ 2JavaScriptupdated 2026-04-05
Israel Fine Checker is an open-source skill and MCP server for checking Israeli parking and HOV/public-transport-route fines through `doh.co.il`, with Hebrew intake prompts and support for 63 municipalities.
★ 3JavaScriptupdated 2026-04-01
Education skills for the Israeli market
★ 1Pythonupdated 2026-04-20
AI skill for Israeli real estate market analysis
★ 4updated 2026-03-29
AI agent skills for Israeli privacy law, GDPR, and regulatory compliance
★ 5Pythonupdated 2026-04-20
AI agent skills for Israeli government APIs and digital services
★ 6Pythonupdated 2026-04-20
Claude Code agent skill: search medications & check real-time stock at Clalit (כללית) pharmacies in Israel
★ 4JavaScriptupdated 2026-02-21agent-skillclalitclaude-codeisraelmedication
An Agent SKILL for Israel Rail API
★ 3updated 2026-03-23ai-agentsclawdbotclawdbot-skillllmopenclaw
AI agent skills for Israeli accounting, bookkeeping, and financial management
★ 6Pythonupdated 2026-04-20
A curated list of Agent Skills for navigating life in Israel
★ 7updated 2026-02-26agent-skillsai-agentsai-toolsawesomeawesome-list
AI agent skills for Israeli tax, invoicing, VAT, and financial systems
★ 13Pythonupdated 2026-04-20
One-stop shop for AI skills and agents. Search 110K+ community skills, install and track them declaratively, and deploy across all major AI coding tools (Claude Code, Codex, Cursor, Antigravity and more)
★ 109Rustupdated 2026-04-19ai-agentsai-skillsai-toolsantigravityclaude
Skills to augment LLM thinking process, integrated with InfraNodus insight generation tool
★ 76Shellupdated 2026-04-11claudeclaude-skillsinfranodusshopping
Convert documentation websites, GitHub repositories, and PDFs into Claude AI skills with automatic conflict detection
★ 13,100Pythonupdated 2026-04-12ai-toolsast-parserautomationclaude-aiclaude-skills
Agent skill for Astro web development, prevents outdated Astro 3/4/5 patterns, covers Tailwind v4, Content Collections v3, MDX, React islands.
★ 12TypeScriptupdated 2026-04-05
Discover and compare open-source Agent Skills, tools & MCP servers — with quality scoring, trending analysis, and automated GitHub sync
★ 203TypeScriptupdated 2026-04-20
Agent skill that audits vibe-coded apps for common security vulnerabilities introduced by AI coding assistants
★ 552updated 2026-03-15
One-click backup & restore for OpenClaw instances — workspace, credentials, skills, agent history. Powered by MyClaw.ai
★ 663Shellupdated 2026-03-03agentbackupclawhubmigrationmyclaw
A curated list of awesome skills, tools, integrations, and resources for Hermes Agent by Nous Research
★ 1,842updated 2026-04-03ai-agentsawesomeawesome-listhermes-agentnous-research
Skills for AI agents working with databases
★ 402HTMLupdated 2026-04-01
Supercharge AI coding agents with portable skills. Install, translate & share skills across Claude Code, Cursor, Codex, Copilot & 40 more
★ 888TypeScriptupdated 2026-04-12agent-skillsagentskillsaiclicodex
Universal Claude Code workflow plugin with agents, skills, hooks, and commands
★ 1,348Pythonupdated 2026-02-14agent-skillsaiai-agentsclaude-codecodex
Agent Skills for Firebase
★ 253JavaScriptupdated 2026-04-17
Bring Agent Skills to Any AI Agent and Coding Agent — via CLI or MCP. Manage once, serve anywhere.
★ 380Pythonupdated 2026-01-08agent-skillsai-agentclaudecodexcontext-engineering
Binance Skills Hub is an open skills marketplace that gives AI agents native access to crypto
★ 770Pythonupdated 2026-04-20agentsaicryptoskills
npx skills add coinbase/agentic-wallet-skills
★ 100JavaScriptupdated 2026-02-20
An open-source AI assistant framework with skills and agent architecture
★ 1,671Pythonupdated 2026-04-20agentaiassistantautomationclaw
An LLM-first SEO analysis skill for Antigravity, Codex, Claude with 16 specialized sub-skills, 10 specialist agents, and 33 optional utility scripts used as evidence collectors.
★ 437Pythonupdated 2026-03-09ai-skillai-skillsantigravity-aiantigravity-skillsantigravity-tools
A collection of standardized Agent Skills to teach GitHub Copilot, Claude, Gemini and Cursor about modern Android development (Kotlin, Jetpack Compose, etc.).
★ 759updated 2026-03-28
Multi-modal Generative Media Skills for AI Agents (Claude Code, Cursor, Gemini CLI). High-quality image, video, and audio generation powered by muapi.ai.
★ 3,099Shellupdated 2026-04-13agent-toolsai-agentsai-artai-musicai-video
Skills for teaching agents how to build on Cloudflare.
★ 1,290updated 2026-04-16agentscloudflareskillsworkers
Self-hosted, open-source agent skill registry for enterprises. Publish & version skill packages, govern with RBAC and audit logs, deploy on-premise with Docker or Kubernetes.
★ 2,642Javaupdated 2026-04-20iflytek-astronopenclawopenclaw-skillsskillskill-hub
A curated list of awesome LLM and AI Agent Skills, resources and tools for customising AI Agent workflows - that works with Claude Code, Codex, Gemini CLI and your custom AI Agents
★ 1,160Pythonupdated 2026-04-16anthropicawesome-listawesome-listsclaude-codeclaude-skills
SkillsBench evaluates how well skills work and how effective agents are at using them
★ 1,056PDDLupdated 2026-04-20
A meta-skill that designs domain-specific agent teams, defines specialized agents, and generates the skills they use.
★ 2,889HTMLupdated 2026-04-18claude-codeclaude-code-pluginharnessharness-engineering
Comprehensive open-source library of AI research and engineering skills for any AI model. Package the skills and your claude code/codex/gemini agent will be an AI research agent with full horsepower. Maintained by Orchestra Research.
★ 7,397TeXupdated 2026-04-13aiai-researchclaudeclaude-codeclaude-skills
Skills for the Gemini API, SDK and model/agent interactions
★ 3,318updated 2026-03-27geminigemini-apiskills
PinchBench is a benchmarking system for evaluating LLM models as OpenClaw coding agents. Made with 🦀 by the humans at https://kilo.ai
★ 1,062Pythonupdated 2026-04-15
Contentful Skills for Claude, tailored for engineers
★ 1Pythonupdated 2026-03-05
yubikey-agent is a seamless ssh-agent for YubiKeys.
★ 2,879Goupdated 2023-12-03cryptographypivsmartcardsshssh-agent
Orchestrate thousands of agents and harnesses as a graph programatically
★ 1,078Pythonupdated 2026-04-15
Hindsight: Agent Memory That Learns
★ 10,782Pythonupdated 2026-04-20agentic-aiagentsai-memorymemory
The filesystem for agents.
★ 3,027Rustupdated 2026-03-25agentsfilesystemsqliteturso
GitHub Agentic Workflows
★ 4,370Goupdated 2026-04-20actionscaiciclaude-codecodex
Reliable Multi-Agent Orchestration Framework
★ 4,236Pythonupdated 2026-04-20
omo; the best agent harness - previously oh-my-opencode
★ 54,169TypeScriptupdated 2026-04-20aiai-agentsampanthropicchatgpt
Open Multi-Agent Interactive Classroom — Get an immersive, multi-agent learning experience in just one click
★ 16,395TypeScriptupdated 2026-04-20
Build local voice agents with open-source models
★ 4,686Pythonupdated 2026-04-20aiassistantlanguage-modelmachine-learningpython
A Desktop Application for Managing Multiple OpenAI Codex CLI Accounts
★ 227Rustupdated 2026-04-20agentcodexopenaiopenai-codextauri
Context-aware AI assistant for your desktop. Ready to respond intelligently, seamlessly integrating multiple LLMs and MCP tools.
★ 5,852C#updated 2026-04-19agentaiavaloniachatclaude
Eigent: The Open Source Cowork Desktop to Unlock Your Exceptional Productivity. Local and Free Alternative to Claude Cowork.
★ 13,753TypeScriptupdated 2026-04-20agent-frameworkagent-skillsagentic-aiagentic-workflowclaude-cowork
🐧Operator-Use: AI that can do stuffs on your computer
★ 33Pythonupdated 2026-04-20ai-agentsbrowser-usecomputer-useopenclawpersonal-assistant
"Aurogen🍊: The Multi-Agent Evolution of OpenClaw."
★ 868TypeScriptupdated 2026-03-21agentchatbotsopenclaw
🦉 OWL: Optimized Workforce Learning for General Multi-Agent Assistance in Real-World Task Automation
★ 19,693Pythonupdated 2026-04-17agentartificial-intelligencemulti-agent-systemstask-automationweb-interaction
"OpenHarness: Open Agent Harness with a Built-in Personal Agent--Ohmo!"
★ 11,229Pythonupdated 2026-04-20
AG-UI: the Agent-User Interaction Protocol. Bring Agents into Frontend Applications.
★ 13,192Pythonupdated 2026-04-20ag-ui-protocolagent-frontendagent-uiagentic-workflowai-agents
Open-source Agent Operating System
★ 17,018Rustupdated 2026-04-19agent-frameworkai-agentsllmmcpopen-source
Agentic orchestrator for parallel coding agents — plans tasks, spawns agents, and autonomously handles CI fixes, merge conflicts, and code reviews.
★ 6,527TypeScriptupdated 2026-04-20agent-fleetagent-swarmclaude-codecodex-cligit-worktrees
JavaScript in-page GUI agent. Control web interfaces with natural language.
★ 17,393TypeScriptupdated 2026-04-17agentaiai-agentsbrowser-automationjavascript
A unified Model Context Protocol server implementation that aggregates multiple MCP servers into one.
★ 423TypeScriptupdated 2026-04-19mcpmcp-clientmcp-gatewaymcp-proxymcp-server
Vercel's official collection of agent skills
★ 25,717JavaScriptupdated 2026-04-17
TradingAgents: Multi-Agents LLM Financial Trading Framework
★ 53,055Pythonupdated 2026-04-13agentfinancellmmultiagenttrading
Coding Agent Session Manager for Claude Code / Gemini CLI / Codex CLI / Cursor Agent / Copilot CLI / Cline CLI / OpenCode / Kimi CLI
★ 1,031TypeScriptupdated 2026-04-20claudeclaude-codecliclinecodex
GitHub Copilot CLI brings the power of Copilot coding agent directly to your terminal.
★ 10,273Shellupdated 2026-04-20
CLI to control iOS and Android devices for AI agents
★ 1,883TypeScriptupdated 2026-04-20agentic-aiagentsautomationmobiletesting
Autonomous novel writing AI Agent — agents write, audit, and revise novels with human review gates
★ 4,969TypeScriptupdated 2026-04-20agentaiai-agentai-novelai-writing
OfficeCLI is the first and best Office suite purpose-built for AI agents to read, edit, and automate Word, Excel, and PowerPoint files. Free, open-source, single binary, no Office installation required.
★ 2,094C#updated 2026-04-19agentaicliofficeopenclaw
CLI and Agent Skill for Firecrawl - Add scrape, search, and browsing capabilities to your AI agents
★ 341TypeScriptupdated 2026-04-16
Agent skills for Obsidian. Teach your agent to use Markdown, Bases, JSON Canvas, and use the CLI.
★ 26,471updated 2026-04-02claudeclawdbotclicodexdefuddle
An open-source autonomous agent powered by Grok.
★ 2,975TypeScriptupdated 2026-04-18agentsaiclicodecoding-agent
Minimal CLI coding agent by Mistral
★ 3,995Pythonupdated 2026-04-16
AI agent toolkit: coding agent CLI, unified LLM API, TUI & web UI libraries, Slack bot, vLLM pods
★ 40,229TypeScriptupdated 2026-04-20
TUI / CLI config manager for agentic harnesses (Amp, Claude Code, Opencode, Goose, Copilot CLI, Crush, Droid)
★ 418Rustupdated 2026-03-14aiampcodeclaude-codecliconfiguration
Open Sans Hebrew Web Font
★ 4CSSupdated 2015-11-17
MCP server for homelab management - Docker, OPNsense, and TrueNAS integration
★ 4TypeScriptupdated 2026-01-07
Prompty makes it easy to create, manage, debug, and evaluate LLM prompts for your AI applications. Prompty is an asset class and format for LLM prompts designed to enhance observability, understandability, and portability for developers.
★ 1,200TypeScriptupdated 2026-04-19generative-aillm-evaluationllmspromptengineeringprompty
🍌 World's largest Nano Banana Pro prompt library — 10,000+ curated prompts with preview images, 16 languages. Google Gemini AI image generation. Free & open source.
★ 11,581TypeScriptupdated 2026-04-20ai-image-generationai-promptsawesomeawesome-listgemini
A Model Context Protocol (MCP) server that provides translation capabilities using the DeepL API.
★ 102JavaScriptupdated 2026-04-08
Hebrew Rashi Typeface
★ 9Pythonupdated 2026-03-30fontgoogle-fontshebrewoflrashi
קול — Professional Transcription Studio. Hebrew-first, 4 engines, YouTube support, correction studio.
★ 81Pythonupdated 2026-04-12
A web app for transliterating Hebrew
★ 18Svelteupdated 2026-04-06hebrewhebrew-biblehebrew-englishold-testamenttransliteration
Heebo open source Hebrew font, designed by Oded Ezer
★ 100Shellupdated 2023-11-23
A tool for transliterating Hebrew
★ 49TypeScriptupdated 2026-01-22hebrewhebrew-biblehebrew-englishtransliteration
EasyList Hebrew is a subscription that removes adverts from Hebrew webpages
★ 74Adblock Filter Listupdated 2026-04-17
What if OpenClaw, Claude Code, Codex etc. knew how to do your work without you saying it? AgentHandover observes you, learns and teaches your agents with self-improving skills.
★ 528Pythonupdated 2026-04-18
★ 54updated 2025-12-28
Chrome extension to let agents control your browser. Runs Playwright snippets in a stateful sandbox. Available as CLI or MCP
★ 3,415HTMLupdated 2026-04-16mcpplaywright
Fast, local-first web content extraction for LLMs. Scrape, crawl, extract structured data — all from Rust. CLI, REST API, and MCP server.
★ 597Rustupdated 2026-04-17aiai-agentsai-scrapingclicrawler
Model Context Protocol Server for Mobile Automation and Scraping (iOS, Android, Emulators, Simulators and Real Devices)
★ 4,709TypeScriptupdated 2026-04-13agentandroidemulatoriosmcp
Calendar sync tool & universal calendar MCP server. Aggregate, sync and control calendars on Google, Outlook, Office 365, iCloud, CalDAV or ICS.
★ 1,028TypeScriptupdated 2026-04-10buncaldavcalendarcalendar-syncgoogle-calendar
Token-efficient MCP server for tabular data retrieval. Index CSV/Excel files, query rows, aggregate — 99%+ token savings vs raw file reads.
★ 38Pythonupdated 2026-04-15
Web Graphical User Interface (GUI) for Gas Town multi-agent orchestrator - A companion interface for steveyegge/gastown
★ 68JavaScriptupdated 2026-04-09agentagent-orchestratoragentic-aiagentic-workflowclaude-code
Control Unreal Engine 5.5+ through AI with natural language. Build incredible 3D worlds and architectural masterpieces using MCP. Create entire towns, medieval castles, modern mansions, challenging mazes, and complex structures with AI-powered commands.
★ 852C++updated 2026-03-26
Open-source CRM with native AI agent support. 30 MCP tools, REST API, self-hosted. Built with Laravel & Filament
★ 1,272PHPupdated 2026-04-20alpinecompanycontactscrmfilament
Automated Miulti AI Agent for company research with LangGraph— scrapes web data, extracts business insights, and generates structured reports using LLM analysis.
★ 112Pythonupdated 2025-10-25
Command Your AI Agent Empire from the CEO Desk — A local-first AI agent office simulator that orchestrates CLI, OAuth, and API-connected agents (Claude Code, Codex CLI, Gemini CLI, OpenCode, and more) as a virtual autonomous company.
★ 1,106TypeScriptupdated 2026-03-16agentic-workflowagentsochestrationopenclawopenclaw-agent
Benchmark for LLMs playing full press diplomacy
★ 61HTMLupdated 2025-03-04
a modern marketplace for ai agents and swam intelligence solutions
★ 1updated 2025-01-13
Fast CLI-first LLM council + bundler + multimodal gateway
★ 4Rustupdated 2026-04-20aiclicode-reviewcoding-agentsllm
Open-source orchestration for zero-human companies
★ 58,889TypeScriptupdated 2026-04-20
The LLM Council works together to answer your hardest questions
★ 18Pythonupdated 2026-03-12llm-agentsllm-as-a-judgellm-councilllm-toolsmcp
18 AI personas deliberate your hardest decisions across multiple LLM providers. Aristotle, Feynman, Kahneman, Torvalds & more — structured multi-round deliberation with genuine model diversity. One command: /council
★ 515Shellupdated 2026-04-15ai-agentsclaudeclaude-codedecision-makingdeliberation
The Operating System for Clear Thinking & Better Decisions
★ 109Pythonupdated 2026-04-05aiai-skillsai-toolsantigravityclaude
🛡️Decision infrastructure for AI agents. Intercept actions, enforce guard policies, require approvals, and produce audit-ready decision trails.
★ 244JavaScriptupdated 2026-04-20agent-frameworkagent-governanceagent-runtimeai-agentsai-infrastructure
An autonomous AI agent here to uncover waste and inefficiencies in government spending and policy decisions
★ 75TypeScriptupdated 2026-03-31
Loomio is a collaborative decision making tool
★ 2,538Rubyupdated 2026-04-20
Hermes skill package for WorldOSINT headless + Polymarket + MiroFish simulation workflows
★ 102Pythonupdated 2026-04-04
Simulate anything, for $1 & less than 10 min — Universal Swarm Intelligence Engine
★ 829Pythonupdated 2026-04-20enginemirofishsimulationswarmswarm-intelligence
Offline multi-agent simulation & prediction engine. English fork of MiroFish with Neo4j + Ollama local stack.
★ 2,024Pythonupdated 2026-03-24aimulti-agentneo4jofflineollama
Multi-agent collaboration plugin for Claude Code - orchestrate multiple AI agents (Codex CLI, Gemini CLI, etc.) for diverse perspectives
★ 131JavaScriptupdated 2025-12-24
Open-source modular stack for AI-enhanced policy making. Includes reusable microservices for data ingestion, simulation, analytics, dashboards, strategy agents, and decision-support tools.
★ 4Pythonupdated 2026-04-10
Resources for those studying the fast-moving pace of AI policy
★ 58updated 2026-03-26
Adversary simulation and Red teaming platform with AI
★ 5,033updated 2026-03-31agentaicobalt-strikellmmcp-server
A flexible multi-interface AI agent framework for building agents with reasoning, tool use, memory, deep research, blockchain interaction, MCP, and agents-as-a-service.
★ 801Pythonupdated 2026-04-07agentic-aiagentic-frameworkaimcp
The Enterprise-Grade Production-Ready Multi-Agent Orchestration Framework. Website: https://swarms.ai
★ 6,543Pythonupdated 2026-04-20agentic-aiagentic-workflowagentsaiartificial-intelligence
Asynchronous coordination layer for AI coding agents: identities, inboxes, searchable threads, and advisory file leases over FastMCP + Git + SQLite
★ 1,896Pythonupdated 2026-04-20ai-agentscoordinationfastmcpmcppython
Continuous Autonomy for the AI SDK
★ 767TypeScriptupdated 2026-01-08experimental
Free, local chat where AI coding agents can tag each other, talk, and coordinate with you.
★ 1,294Pythonupdated 2026-04-19
The Best AI Agent Framework for Agent Collaboration.
★ 908Pythonupdated 2026-04-20agentagentic-aillmopenonion
RLinf: Reinforcement Learning Infrastructure for Embodied and Agentic AI
★ 3,183Pythonupdated 2026-04-20agentic-aiembodied-aireinforcement-learningrl-infrarlinf
Terminal session manager for AI coding agents. One TUI for Claude, Gemini, OpenCode, Codex, and more.
★ 2,182Goupdated 2026-04-20ai-agentai-agentsai-coding-assistantaiderbubble-tea
The AI Agent Workforce Platform — where teams scale beyond headcount. Give every team member an AI agent squad.
★ 1,738Goupdated 2026-04-19agent-orchestrationagentsmeshai-agentai-agent-workforce-platformai-coding
Squad: AI agent teams for any project
★ 2,331TypeScriptupdated 2026-04-20
Klavis AI: MCP integration platforms that let AI agents use tools reliably at any scale
★ 5,718Pythonupdated 2026-04-20agentsaiai-agentsapideveloper-tools
Create state-machine-powered LLM agents using XState
★ 350TypeScriptupdated 2026-04-10agentsaillmstate-machinestatechart
Taste-Skill (High-Agency Frontend) - gives your AI good taste. stops the AI from generating boring, generic, "slop"
★ 12,987Shellupdated 2026-04-19agentaicodinglowcodenocode
OpenAgents - AI Agent Networks for Open Collaboration
★ 3,307Pythonupdated 2026-04-20agentsaicollaborationllmnetwork
A clean, modular SDK for building AI agents with OpenHands V1.
★ 672Pythonupdated 2026-04-20agentsdk
Research into how agentic AI coding assistants work — reconstructed prompt patterns, agent coordination, and security classification
★ 2,349updated 2026-03-31agentic-aiai-researchclaudeprompt-engineeringsystem-prompts
Bridge Claude Code / Codex to IM platforms — chat with AI coding agents from Telegram, Discord, or Feishu/Lark.
★ 2,344TypeScriptupdated 2026-03-23chatbotclaudeclaude-codediscordfeishu
Allow all your Claude Codes to message each other ad-hoc!
★ 1,934TypeScriptupdated 2026-03-21
Context management for Claude Code. Hooks maintain state via ledgers and handoffs. MCP execution without context pollution. Agent orchestration with isolated context windows.
★ 3,731Pythonupdated 2026-01-26agentsclaude-codeclaude-code-cliclaude-code-hooksclaude-code-mcp
Put up to 8 AI models on every coding task — blind spots surface before you ship. Claude Code plugin.
★ 2,844Shellupdated 2026-04-20ai-agentsai-orchestrationclaude-codeclaude-code-plugincodex
Semi-automated research assistant for academic research and software development. Supports Claude Code, OpenCode, and Codex CLI across ideation, coding, experiments, writing, and publication.
★ 3,447Pythonupdated 2026-04-15academic-researchai-agentsclaudeclaude-codecodex-cli
Open Source version of Claude Cowork with 500+ SaaS app integrations
★ 3,980JavaScriptupdated 2026-03-05aiagentsanthropicanthropic-claudeclaude-codeclaude-cowork
Marketing skills for Claude Code and AI agents. CRO, copywriting, SEO, analytics, and growth engineering.
★ 24,794JavaScriptupdated 2026-04-13claudecodexmarketing
Universal SEO skill for Claude Code. 19 sub-skills, 12 subagents, 3 extensions (DataForSEO, Firecrawl, Banana). Technical SEO, E-E-A-T, schema, GEO/AEO, backlinks, local SEO, maps intelligence, Google APIs, and PDF/Excel reporting.
★ 5,467Pythonupdated 2026-04-15aiai-seoclaude-codeclaude-code-skillmarketing-automation
A cross-platform desktop All-in-One assistant tool for Claude Code, Codex, OpenCode, openclaw & Gemini CLI.
★ 51,481Rustupdated 2026-04-20ai-toolsclaude-codecodexdesktop-appmcp
A curated list of OpenClaw resources, tools, skills, tutorials & articles. OpenClaw (formerly Moltbot / Clawdbot) — open-source self-hosted AI agent for WhatsApp, Telegram, Discord & 50+ integrations.
★ 900updated 2026-04-14agentic-aiai-agentai-automationautonomous-agentsawesome
The largest open-source medical AI skills library for OpenClaw🦞.
★ 2,167Pythonupdated 2026-03-27awesomeclaude-codeclawhubmedicalnanoclaw
OpenClaw-RL: Train any agent simply by talking
★ 5,129Pythonupdated 2026-04-19asynccodinggrpogui-applicationmemory-systems
A next-generation AI-powered career platform transforming how employers and job seekers connect
★ 493TypeScriptupdated 2026-03-25cloudinaryfirebasegemini-apinextjsstripe
All-in-one platform for search, recommendations, RAG, and analytics offered via API
★ 2,641Rustupdated 2026-01-25actixactix-webaiartificial-intelligencediesel
Best Practices on Recommendation Systems
★ 21,660Pythonupdated 2026-04-18aiartificial-intelligencedata-sciencedeep-learningjupyter-notebook
A complete AI agency at your fingertips - From frontend wizards to Reddit community ninjas, from whimsy injectors to reality checkers. Each agent is a specialized expert with personality, processes, and proven deliverables.
★ 87,002Shellupdated 2026-04-12
One desktop to manage your agent skills
★ 579TypeScriptupdated 2026-03-07agentskillsaidesktop-appproductivity
A multi-model AI agent desktop client — connect any AI provider, extend with MCP & skills, control from your phone. Built with Electron + Next.js.
★ 5,553TypeScriptupdated 2026-04-19aianthropicclaudeclaude-codedesktop-app
Your local AI Desktop Agent for Windows, macOS & Linux. Agent Skills (SKILL.md), autonomous coding (Codework), multi-agent teams, desktop automation, 15+ AI providers, Desktop Buddy. No Docker, no terminal. Free.
★ 860TypeScriptupdated 2026-04-20ai-agentai-assistantai-companionsautomationautonomous-agent
ClawX is a desktop app that provides a graphical interface for OpenClaw AI agents. It turns CLI-based AI orchestration into a desktop experience without using the terminal. China website is https://clawx.com.cn.
★ 6,731TypeScriptupdated 2026-04-20agentagentic-aiagentsaiclawdbot
🚨 Israeli Home Front Command real-time alerts via OpenClaw - WhatsApp + TTS, no Home Assistant needed
★ 1Pythonupdated 2026-03-02
The official implementation of "A Language Modeling Approach to Diacritic-Free Hebrew TTS"
★ 109Pythonupdated 2025-06-12aihebrewslmstts
Automatically sync recurring Hebrew calendar events, like birthdays and anniversaries, to your digital calendar
★ 25SCSSupdated 2026-04-13djangohebrewicalicalendarics
A Python package for manipulating Hebrew (Jewish) calendar dates and Hebrew-Gregorian conversion.
★ 68Pythonupdated 2026-01-29calendarhebrew-calendarhebrew-datejewishjewish-calendar
Hebrew Diacritizer
★ 50Pythonupdated 2026-04-14diacritizationhebrewhebrew-niqqudmachine-learning
AI agent skill for Israeli movie showtimes, ratings, and cinema info from seret.co.il
★ 5updated 2026-04-04
LLM-powered agentic system for Israeli Knesset election analysis — comparing 4 tool routing strategies (DS-UA 301)
★ 2Pythonupdated 2026-04-05
Agentic RAG system for architecture firms to query Israeli planning regulations and local projects
★ 1Pythonupdated 2026-03-24
OpenAPI specification for the Sofer.Ai API
★ 1Shellupdated 2026-03-30mediaopenapitorah
Library and tool for downloading media and content from Torah websites.
★ 7Pythonupdated 2026-04-17mediapythontorah
Morning (Green Invoice) skill for AI agents — expense management, presigned S3 file upload, classifications, and search.
★ 2updated 2026-04-14accountingai-skillclaude-codeexpensesgreen-invoice
Smart personal finance tracker for Israeli banks & cards. Features AI categorization, recurring payments, self-hosting (Docker), and MCP support.
★ 13TypeScriptupdated 2026-04-13aibudgetingdockerisraelmcp
An MCP (Model Context Protocol) server for searching and browsing products on KSP.co.il — one of Israel's largest electronics and retail stores.
★ 3TypeScriptupdated 2026-03-28
MCP server for Israel's RedAlert emergency alert system - real-time alerts, statistics, shelter search, and city data
★ 6TypeScriptupdated 2026-03-18
Collection of MCP servers for Israeli data sources and APIs
★ 3TypeScriptupdated 2026-04-19
🔥 Comprehensive survey on Context Engineering: from prompt engineering to production-grade AI systems. hundreds of papers, frameworks, and implementation guides for LLMs and AI agents.
★ 3,085updated 2026-03-10agentagentic-aiagiawesome-listcognitive-science
Unified benchmark for evaluating conversational memory and RAG across multiple datasets
★ 248TypeScriptupdated 2026-03-27aiai-memorybenchmark-framework
AI memory OS for LLM and Agent systems(moltbot,clawdbot,openclaw), enabling persistent Skill memory for cross-task skill reuse and evolution.
★ 8,685TypeScriptupdated 2026-04-20agentagent-memoryclawdbotllmllm-memory
Awesome AI Memory | LLM Memory | A curated knowledge base on AI memory for LLMs and agents, covering long-term memory, reasoning, retrieval, and memory-native system design. Awesome-AI-Memory 是一个 集中式、持续更新的 AI 记忆知识库,系统性整理了与 大模型记忆(LLM Memory)与智能体记忆(Agent Memory) 相关的前沿研究、工程框架、系统设计、评测基准与真实应用实践。
★ 784Pythonupdated 2026-04-18agent-memoryai-memoryai-memory-systemawesome-ai-memorycontinual-learning
Open-source persistent memory for AI agent pipelines (LangGraph, CrewAI, AutoGen) and Claude. REST API + knowledge graph + autonomous consolidation.
★ 1,730Pythonupdated 2026-04-19agent-memoryagentic-aiai-agentsautogenclaude
A list of AI memory projects
★ 741Pythonupdated 2025-01-10aiai-agentsai-engineeringai-memoryai-ml
A curated list of awesome Public Zettelkastens 🗄️ / Second Brains 🧠 / Digital Gardens 🌱
★ 1,760updated 2026-02-18digital-gardensecond-brainzettelkasten
Agents are only as good as their context but most context lives in scattered traces: coding agent sessions, IDE chats, tool calls, and personal messages. We wanted a continual learning context engine that can securely extract memory from real activity, so agents can cold-start with high-signal history and stay current as you work
★ 21Pythonupdated 2026-04-07
A curated list of tools for building AI with rich context from screen recordings, audio, and personal data
★ 24updated 2026-01-25
Personal Context Manager for Claude Code. Your life in walnuts.
★ 82Pythonupdated 2026-04-20ai-agentai-toolsanthropicautomationclaude-code
A personal context store for AI agents and assistants—reuse your existing coding agent CLI (Codex/Claude/OpenCode) with built‑in Skills/tools and a desktop GUI to capture, search, and reuse project knowledge across agents and repos.
★ 524JavaScriptupdated 2026-01-30agentaiai-agentsclaude-codecli
🎯 A unified personal data hub built on MCP that allows AI assistants to access your digital life from Steam, YouTube, Bilibili and more platforms for truly personalized interactions.
★ 52Pythonupdated 2026-03-24
ResearchClaw is a personal AI assistant built for research: fast to set up, easy to run locally or in the cloud, and ready to integrate with the chat apps you already use. With extensible skills, it helps you streamline literature review, note-taking, experiment tracking, and paper writing—end to end.
★ 278Pythonupdated 2026-04-04agentcopawopenclawpersonalresearch
Management console for the Null ecosystem — install, configure, and monitor AI agents, orchestration workflows, task pipelines, and system health
★ 91Zigupdated 2026-04-18aiassistantnullclawpersonalzig
A context and memory system for AI coding agents. Persistent memory, personal rules, skills, and scheduled observations
★ 419Pythonupdated 2026-04-17
A universal git-native AI agent framework. Your agent lives inside a git repo — identity, rules, memory, tools, and skills are all version-controlled files.
★ 273TypeScriptupdated 2026-04-22ai-agentsanthropicassistantllmopenclaw
Personal Agentic AI Assistant for non-tech user powered by OpenClaw
★ 157TypeScriptupdated 2026-04-20agent-skillsagentic-aiaiai-agentsai-assistant
Your personal AI assistant that remembers everything across Telegram, Slack, WhatsApp, and Signal
★ 321TypeScriptupdated 2026-04-20
An AI-powered personal productivity system where knowledge management and daily task planning are intelligently orchestrated by your AI assistant.
★ 764updated 2026-03-15
Simple Graph Memory for AI applications
★ 104Jupyter Notebookupdated 2026-02-23databasedspygraphsqlite3vector-database
A unified AI model hub for aggregation & distribution. It supports cross-converting various LLMs into OpenAI-compatible, Claude-compatible, or Gemini-compatible formats. A centralized gateway for personal and enterprise model management. 🍥
★ 28,941Goupdated 2026-04-18ai-gatewayclaudedeepseekgemininewapi
Build, evaluate, and integrate long-term memory for self-evolving agents.
★ 4,212Pythonupdated 2026-04-20agent-memoryagentic-aiaichatsclawdbot
AI-powered CMS core for personal blogs and creator websites, with AI summaries, translation, moderation, and writing workflows.
★ 522TypeScriptupdated 2026-04-20aiai-cmsai-summaryai-translationblog-cms
N.E.K.O. — A proactive, native omni AI companion featuring 24/7 ambient awareness and an embodied emotional engine.
★ 995Pythonupdated 2026-04-20ai-agentsjarvis-assistantown-your-datapersonalwaifu
Personal AI, On Personal Devices
★ 3,147Pythonupdated 2026-04-20
Token-efficient browser MCP server — structured web pages for AI agents, not raw accessibility dumps
★ 134TypeScriptupdated 2026-04-17ai-agentsmcpmcp-servermodel-context-protocoltypescript
OpenBrowser is a framework for intelligent browser automation. It combines direct CDP communication with a CodeAgent architecture, where the LLM writes Python code executed in a persistent namespace, to navigate, interact with, and extract information from web pages autonomously.
★ 229Pythonupdated 2026-04-15aiai-agentsai-browserai-browser-automationartificial-intelligence
A secure and user-friendly web app for managing Linux servers with Artifical Intelligence via SSH—right from your browser.
★ 342JavaScriptupdated 2025-08-28aisshwebssh
Open-source alternative to Claude Cowork - Browser automation & AI assistant powered by DeepSeek
★ 188JavaScriptupdated 2026-02-11claude-cowork-alternativedeepseekdeepseek-coworkopen-sourceopenwork
A browser-based desktop where AI Agent operates every app through natural language.
★ 1,123TypeScriptupdated 2026-04-14ai-agentbrowserdesktopmicro-frontendminimax
The missing DevTools for Claude Code — inspect session logs, tool calls, token usage, subagents, and context window in a visual UI. Free, open source.
★ 3,192TypeScriptupdated 2026-04-18aiai-agentai-debuggingai-toolsanthropic
Browser automation for AI agents and humans
★ 2,784Goupdated 2026-03-18
Your browser is the API. CLI + MCP server for AI agents to control Chrome with your login state.
★ 4,798TypeScriptupdated 2026-04-19
Browser4: a lightning-fast, coroutine-safe browser for your AI.
★ 1,039Kotlinupdated 2026-04-20agentic-aiagentic-browserai-browserbrowser-agentbrowser-infra
🌎💪 BrowserGym, a Gym environment for web task automation
★ 1,206Pythonupdated 2026-03-17aillmwebagent
PhyAgentOS is a self-evolving embodied AI operating system built on agentic workflows.
★ 211Pythonupdated 2026-04-15agentembodied-agentembodied-aiharness
OpenHarness For Codex is a specialized variant of the OpenHarness framework designed for AI-driven software development
★ 47Pythonupdated 2026-03-31
A comprehensive framework to test audio comprehension of Large Audio Language Models.
★ 61Pythonupdated 2026-04-19
OpenHarness is a long-term, fully autonomous AI agent execution framework for OpenClaw built on the concept of Harness Engineering. It enables your AI to work tirelessly for you 24/7 with just a single command. syycy2021@gmail.com, From the Interdisciplinary Professor Shenyang Team at Tsinghua University
★ 92Pythonupdated 2026-04-01controlling-ai-with-a-mobile-phoneharness-engineeringopenclawopenclaw-pluginthe-never-stopping-ai
🛠️ Awesome tools & guides for harness engineering.
★ 2,007updated 2026-04-14
autonomous harness engineering
★ 4,309Pythonupdated 2026-04-03
The best agent harness.
★ 6,285Pythonupdated 2026-04-20agentic-codingai-workflowclaudecodecodexharness
A framework for few-shot evaluation of language models.
★ 12,325Pythonupdated 2026-04-08evaluation-frameworklanguage-modeltransformer
Quantitative geopolitical risk dashboard tracking Iran-Israel conflict escalation via market signals, GDELT news analytics, and probabilistic portfolio regime guidance.
★ 3Jupyter Notebookupdated 2026-04-19conflict-predictiongdeltgeopolitical-riskgoogle-colabiran
Minute-by-minute timeline of Feb 28, 2026 — US & Israel strikes on Iran. Open source. Feel free to contribute, add news events, and submit PRs!
★ 27TypeScriptupdated 2026-04-04
Iran War Media Monitor collects news articles covering the US-Israeli war on Iran and applies sentiment analysis to uncover who supports and opposes the war.
★ 17Pythonupdated 2026-03-24
HaluMem is the first operation level hallucination evaluation benchmark tailored to agent memory systems.
★ 126Pythonupdated 2026-01-08aibenchmarkhallucinationhallucination-evaluationllm
Automated system for LLM evaluation via agents.
★ 97Pythonupdated 2026-04-13agentagentsbenchmarkdatadata-analysis
A comprehensive evaluation framework for AI agents and LLM applications.
★ 110Pythonupdated 2026-04-17agenticagentic-aiaievaluationmachine-learning
LLM-powered framework for deep document understanding, semantic retrieval, and context-aware answers using RAG paradigm.
★ 14,005Goupdated 2026-04-20agentagenticaichatbotchatbots
A list of LLM benchmark frameworks.
★ 74updated 2024-02-17awesome-listbenchmarkevaluationllm
Moonshot - A simple and modular tool to evaluate and red-team any LLM application.
★ 320Pythonupdated 2026-02-05benchmarkingevaluation-frameworkllmred-teamingtrustworthy-ai
A curated collection of AI agent research papers released in 2026, covering agent engineering, memory, evaluation, workflows, and autonomous systems.
★ 672updated 2026-04-16ai-agentsawesomeawesome-listllmllm-agents
High-performance LLM evaluation framework with parallel API calls — up to 17× faster than sequential tools. Supports box, math, and logit-based evaluation.
★ 96Pythonupdated 2026-04-11evalevaluationllm
📰 Must-read papers and blogs on LLM based Long Context Modeling 🔥
★ 1,974updated 2026-04-15agentawsome-listbenchmarkblogscompress
Claw-Eval is an evaluation harness for evaluating LLM as agents. All tasks verified by humans.
★ 495Pythonupdated 2026-04-15agentharnessllmopenclaw
A Dynamic Environment to Evaluate Attacks and Defenses for LLM Agents.
★ 542Pythonupdated 2026-03-30benchmarklarge-language-modelsprompt-injectionsecurity
AutoRAG: An Open-Source Framework for Retrieval-Augmented Generation (RAG) Evaluation & Optimization with AutoML-Style Automation
★ 4,727Pythonupdated 2026-04-18analysisautomlbenchmarkingdocument-parserembeddings
Awesome-Jailbreak-on-LLMs is a collection of state-of-the-art, novel, exciting jailbreak methods on LLMs. It contains papers, codes, datasets, evaluations, and analyses.
★ 1,323updated 2026-03-30aijailbreakllmllmsprivacy
AI Agent Evaluator & Red Team Platform
★ 1,025Pythonupdated 2026-04-19agentsaiai-agentse2e-testingllm
Open-source evaluation toolkit of large multi-modality models (LMMs), support 220+ LMMs, 80+ benchmarks
★ 4,079Pythonupdated 2026-04-10chatgptclaudeclipcomputer-visionevaluation
The official repo for paper, LLMs-as-Judges: A Comprehensive Survey on LLM-based Evaluation Methods.
★ 565updated 2025-07-29
OpenCompass is an LLM evaluation platform, supporting a wide range of models (Llama3, Mistral, InternLM2,GPT-4,LLaMa2, Qwen,GLM, Claude, etc) over 100+ datasets.
★ 6,935Pythonupdated 2026-04-16benchmarkchatgptevaluationlarge-language-modelllama2
Readymade evaluators for your LLM apps
★ 1,037Pythonupdated 2026-04-16
A streamlined and customizable framework for efficient large model (LLM, VLM, AIGC) evaluation and performance benchmarking.
★ 2,723Pythonupdated 2026-04-20evaluationllmperformanceragvlm
Reproducible, flexible LLM evaluations
★ 366Pythonupdated 2026-03-24
The platform for LLM evaluations and AI agent testing
★ 3,224TypeScriptupdated 2026-04-20aianalyticsdatasetsdspyevaluation
Lighteval is your all-in-one toolkit for evaluating LLMs across multiple backends
★ 2,391Pythonupdated 2026-04-17evaluationevaluation-frameworkevaluation-metricshuggingface
The papers are organized according to our survey: Evaluating Large Language Models: A Comprehensive Survey.
★ 800updated 2024-05-08
Gorilla: Training and Evaluating LLMs for Function Calls (Tool Calls)
★ 12,851Pythonupdated 2026-04-13apiapi-documentationchatgptclaude-apigpt-4-api
Evaluation and Tracking for LLM Experiments and AI Agents
★ 3,269Pythonupdated 2026-04-20agent-evaluationagentopsai-agentsai-monitoringai-observability
🦞 MCP server for OpenClaw - secure bridge between Claude.ai and your self-hosted OpenClaw assistant with OAuth2 authentication
★ 146TypeScriptupdated 2026-03-31docker-composemcp-serveropen-clawproductivitysecurity
Home Assistant MCP server agent. Enable Claude Code, Cursor, VS Code or any MCP-enabled IDE to help you vibe-code and manage Home Assistant: create and debug automations, design dashboards, tweak themes, modify configs, and deploy changes using natural language
★ 528Pythonupdated 2026-04-18claudeclaudecodecopilot-enabledcursor-aihome-assistant
Home Assistant skills for agents
★ 332updated 2026-04-06
The Unofficial and Awesome Home Assistant MCP Server
★ 2,555Pythonupdated 2026-04-20
Does Socialization Emerge in AI Agent Society? A Case Study of Moltbook
★ 18Pythonupdated 2026-02-17
The brutally honest guide to 200+ AI agent platforms. Tier S-D ratings, x402 economy, 68+ CVEs, bug bounty pipeline. I registered on 200+ platforms so you don't have to.
★ 49Dockerfileupdated 2026-04-20agent-economyai-agentai-agentsaiagentawesome
Data collection from Moltbook for research
★ 52HTMLupdated 2026-04-12aiaiagentmoltbook
Long-term memory layer for OpenClaw & MoltBook agents that learns and recalls your project context automatically.
★ 248TypeScriptupdated 2026-03-25aiclaudeclaude-codemcpmemory
📚 Real-world OpenClaw automation examples from Moltbook
★ 961updated 2026-03-24awesomeopenclaw
MCP server for Moltbook — the social network for AI agents
★ 10JavaScriptupdated 2026-04-20
AI Agent Orchestration Dashboard - Manage AI agents, assign tasks, and coordinate multi-agent collaboration via OpenClaw Gateway.
★ 3,829TypeScriptupdated 2026-04-06ai-agentsautomationopenclaworchestration
OpenClaw for Teams
★ 3,381Pythonupdated 2026-04-20agentllmmultiagentopenclaw
Skill Directory for OpenClaw
★ 8,274TypeScriptupdated 2026-04-19directoryskill
Example projects that demonstrate how to use Expo APIs and integrate Expo with other popular tools
★ 3,562TypeScriptupdated 2026-04-20examplesexpoexpo-examplesexpo-webreact-native
Production-ready MCP server for Donetick chores management with JWT authentication, Full API support, and 10 MCP tools
★ 6Pythonupdated 2025-11-18apichoresclaudedonetickmcp
An Android application that is a thin wrapper for Donetick providing native mobile notifications for everything on your list
★ 4Kotlinupdated 2025-06-29androidself-hosted
Donetick Frontend
★ 21JavaScriptupdated 2026-04-12
Donetick Homeassistant Integration
★ 58Pythonupdated 2026-04-16donetickhacshomeassistantintegrationtask-manager
CLI for Gl.iNet routers
★ 3JavaScriptupdated 2026-04-15
A collection of utility scripts and tools for managing and automating common tasks on GL.iNet (OpenWrt-based) routers.
★ 80updated 2026-04-19glinetopenwrt
This script enables the Automated Certificate Management Environment (ACME) for GL.iNet routers.
★ 24Shellupdated 2026-04-19acmeglinetopenwrt
GLiNet Router HomeAssistant integration
★ 49Pythonupdated 2025-07-17
Automated Tailscale updater for GL.iNet routers: periodically checks for new releases, downloads the correct build, and installs/updates Tailscale reliably via script (for OpenWrt/GL.iNet firmware)
★ 590Shellupdated 2026-04-19gl-inetglinetheadscaleopenwrttailscale
All ipks for GL.iNet's official firmware.
★ 172Makefileupdated 2024-08-02
Nuxt Dashboard Template made with Nuxt UI.
★ 980Vueupdated 2026-04-20dashboardnuxtnuxt-uivue
TimesFM (Time Series Foundation Model) is a pretrained time-series foundation model developed by Google Research for time-series forecasting.
★ 18,581Pythonupdated 2026-04-15
EmDash is a full-stack TypeScript CMS based on Astro; the spiritual successor to WordPress
★ 10,040TypeScriptupdated 2026-04-20astrocmsemdashtypescript
AI enabled pair programmer for Claude, GPT, O Series, Grok, Deepseek, Gemini and 300+ models
★ 6,974Rustupdated 2026-04-20ai-pair-programmingai-workflowsartifical-intelligenseclaude-3-7-sonnetclaude-4
OmX - Oh My codeX: Your codex is not alone. Add hooks, agent teams, HUDs, and so much more.
★ 25,917TypeScriptupdated 2026-04-20
Integration to Sector Alarm for Home Assistant
★ 55Pythonupdated 2026-03-03alarmalarm-controlalarm-control-panellocksector
Worlds First AI Video Editor and Voice Cloner
★ 52Pythonupdated 2026-04-11
All-in-one steganography suite
★ 1,321HTMLupdated 2026-04-02steganalysissteganographystego
The free build of Claude Code. All telemetry removed, security-prompt guardrails stripped, all experimental features enabled.
★ 8,110TypeScriptupdated 2026-04-01
Hebrew whisper powerful transcription and translation tool
★ 74Pythonupdated 2024-05-15
Learn Python for free using open-source notebooks in Hebrew.
★ 1,085Jupyter Notebookupdated 2025-04-18jupyter-notebooklearn-by-doinglearn-pythonlearn-to-codelearn-to-code-for-free
YOLOv8-based drone detection model for real-time identification of drones, UAVs, birds, and airplanes. Developed after the 12-day Iran-Israel conflict to enhance aerial threat monitoring.
★ 5updated 2025-11-11aidrone-detectionobject-detectionuavyolov8
MagenYehudaBot — Iran-Israel real-time intelligence monitor. Multi-source OSINT, satellite fire detection, seismic monitoring, internet blackout detection, military flight tracking, Telegram delivery.
★ 5HTMLupdated 2026-03-30
★ 1HTMLupdated 2026-04-20
Automated Israeli DevOps/AI/Agentic job monitor — scrapes, updates dashboard, deploys to Netlify, notifies Slack
★ 1HTMLupdated 2026-04-20
★ 1Pythonupdated 2026-04-20
Live war dashboard covering the conflict between the U.S., Israel and allied forces against Iran
★ 1HTMLupdated 2026-04-20
Historical data of Israel's Home Front Command (פיקוד העורף) alerts.
★ 20updated 2026-04-18
A minimal Israel-timezone status line for Claude Code — know when the 2X doubled-usage promotion is active
★ 21Pythonupdated 2026-04-20
Rocket / mortar alarms in Israel
★ 69HTMLupdated 2026-04-20
AI agent network that connects to Israeli open data sources - ask questions in Hebrew, get answers grounded in real data with charts and sources.
★ 125TypeScriptupdated 2026-04-16
Opening the Israeli Budget!
★ 77updated 2026-02-17
Automated budget tracking from Israeli financial institutions
★ 250TypeScriptupdated 2026-04-17budgetbudget-trackingfinancefinance-managementisraeli
Israel Rail API and CLI in Node.js (npx)
★ 4TypeScriptupdated 2026-04-03
DevRel Content Writer AI agent
★ 3TypeScriptupdated 2026-03-30
Build Awesome MCPs with Awesome Best Practices for MCP Servers and MCP Clients
★ 75updated 2025-08-16awesomeawesome-listllmmcpmcp-server
★ 173Astroupdated 2026-03-03
Unify multiple MCP Servers & Skills into a single gateway — with proxy forwarding, authentication, and a management API. Typical use: expose local stdio servers as remote MCP endpoints, then use them in any web-based AI chat via a browser extension. 将多个 MCP Server 与 Skill 统一接入单一网关,提供转发、认证与管理 API。 典型用途:将本地 stdio 服务暴露为远程 MCP 端点,配合插件在网页 AI 聊天中直接调用。
★ 122Rustupdated 2026-03-30
★ 17Pythonupdated 2025-04-30
MCP Server for OPNSense to act as IaC proxy
★ 45TypeScriptupdated 2026-04-16
A collection of tools for your LLMs that run on Modal
★ 26Pythonupdated 2025-02-28
★ 15Pythonupdated 2025-09-10g2phebrewtts
Next generation Cosmic desktop environment
★ 6,093Justupdated 2026-04-14
The open-source AI voice studio. Clone, dictate, create.
★ 23,403TypeScriptupdated 2026-04-20aicudamlxqwen3-ttsqwen3-tts-ui
A Model Context Protocol (MCP) server for ZigBee2MQTT that provides intelligent device discovery and control for AI assistants
★ 5TypeScriptupdated 2025-10-19claude-aidockerhome-automationiotmcp
★ 58TypeScriptupdated 2026-02-22
Using ffmpeg command line to achieve an mcp server, can be very convenient, through the dialogue to achieve the local video search, tailoring, stitching, playback,clip, overlay, concat and other functions
★ 132Pythonupdated 2025-05-13
The (official) Music Assistant Mobile app is a cross-platform client application designed for Android, iOS, and Java runtime environments. Developed using Kotlin Multiplatform (KMP) and Compose Multiplatform frameworks, this project aims to provide a unified codebase for seamless music management across multiple platforms.
★ 285Kotlinupdated 2026-04-15androidandroid-apphome-assistantiosios-app
Music Assistant add-on (repository) for Home Assistant
★ 188Shellupdated 2026-04-20
Studio Code Server - Home Assistant Community Add-ons
★ 648Dockerfileupdated 2026-04-16addonaddonscode-serverhome-assistanthomeassistant
Qiskit is an open-source SDK for working with quantum computers at the level of extended quantum circuits, operators, and primitives.
★ 7,302Pythonupdated 2026-04-20cpythonqiskitquantumquantum-circuit
Open-source credential vault, give your AI agents access to services without exposing keys.
★ 1,970TypeScriptupdated 2026-04-20ai-agentsclimcpnanoclawnodejs
Boris Cherny's Claude Code configuration - commands, agents, and settings
★ 242updated 2026-03-30
Boris Cherny's Claude Code configuration - commands, agents, and settings
★ 1updated 2026-02-03
MQTT IO - Home Assistant Community Add-ons
★ 88Dockerfileupdated 2026-04-13addonaddonsgpiohome-assistanthomeassistant
An index of my Claude Code related repos including a wide variety of starter templates for using Claude Code for common and more imaginative purposes!
★ 1updated 2026-03-27
Synchronous multiroom audio player
★ 2C++updated 2025-04-08
Python API for controlling Snapcast, a multi-room synchronous audio solution.
★ 1Pythonupdated 2025-05-19
为你 7*24 在线搞钱的“云上牛马”团队
★ 8,170TypeScriptupdated 2026-04-19crawlerdigital-employeemakemoneymasmulti-agent
Meshtastic project website and documentation
★ 1,805TypeScriptupdated 2026-04-19meshtastic
Backup photos from Google Photos using Playwright.
★ 258JavaScriptupdated 2025-01-25backupdownloaddownloadergooglegooglephoto
Samples for the Google Photos Library API 📸
★ 525JavaScriptupdated 2026-04-02google-photossample
Google Photos and Albums backup with Google Photos Library API
★ 2,081Pythonupdated 2026-03-17albumsbackupgooglegoogle-photosgoogle-photos-albums
A self-hosted web radio management suite, including turnkey installer tools for the full radio software stack and a modern, easy-to-use web app to manage your stations.
★ 3,824PHPupdated 2026-04-17icecastliquidsoapradioradio-stationshoutcast
🔈 Sonos Media Player Interface/Client
★ 719JavaScriptupdated 2026-04-15home-automationjavascriptmusicnodejssonos
fully accessible cross-browser HTML5 media player.
★ 815JavaScriptupdated 2026-04-20
An extensible, plugin-oriented, HTML5-first media player for the web
★ 7,451JavaScriptupdated 2026-04-20clapprdashhlshtml5-audiohtml5-video
A React component for playing a variety of URLs, including file paths, YouTube, Facebook, Twitch, SoundCloud, Streamable, Vimeo, Wistia and DailyMotion
★ 10,218TypeScriptupdated 2025-11-13audiodailymotiondashfacebookhls
HTML5 <audio> or <video> player with support for MP4, WebM, and MP3 as well as HLS, Dash, YouTube, Facebook, SoundCloud and others with a common HTML5 MediaElement API, enabling a consistent UI in all browsers.
★ 8,298JavaScriptupdated 2025-11-12dashflashhlshtml5html5-audio
Minimalistic media card for Home Assistant Lovelace UI
★ 1,696TypeScriptupdated 2026-03-06automationcustomhacktoberfesthassiohome-assistant
UI components and hooks for building video/audio players on the web. Robust, customizable, and accessible. Modern alternative to JW Player and Video.js.
★ 3,485TypeScriptupdated 2026-04-19accessibilityanalyticsaudiohlshtml
A WhatsApp client library for NodeJS that connects through the WhatsApp Web browser app
★ 21,687JavaScriptupdated 2026-04-19apibotbot-apihacktoberfestwhatsapp
V1Claw is a self-hosted AI assistant that runs on your Mac, Linux, Windows, or Android via Termux. Connect any LLM (Claude, GPT, Gemini, or local), talk to it through voice or text, and let it control your device - read files, run commands, browse the web, send messages, & more. One binary. No cloud dependency. Your data stays on your machine.
★ 6Goupdated 2026-04-18agentagentic-aiaiclawclawbot
Text-to-speech plugin for Claude Code — multi-provider support (ElevenLabs, OpenAI, Google, Amazon Polly, Azure, Kitten, local system TTS) on macOS, Linux, and Windows
★ 24Shellupdated 2026-04-15accessibilityaudioclaude-codeclaude-code-pluginelevenlabs
官方推荐的 ChatTTS 资源汇总项目,整理了全网相关资源和常见问题 || Officially recommended ChatTTS resource collection project
★ 1,863updated 2024-07-03aichattts
A fully local and private Speech-To-Text app with cross-platform support, speaker diarization, Audio Notebook mode, LM Studio integration, and both longform and live transcription.
★ 396TypeScriptupdated 2026-04-19diarizationdictationdockerfaster-whisperlinux
audiov is a speech-to-text, voice-typing, dictation software for linux distributions.
★ 36Rustupdated 2026-03-14
A fully local, open-source voice-to-text tool that acts as a system-wide AI dictation layer, converting speech into clean, formatted text.
★ 35Goupdated 2026-04-13clidarwingolanglinuxllm-tools
Speech-to-text for Linux that just works
★ 23Rustupdated 2026-04-09dictationspeech-to-textwhisper-cpp
sherpa-onnx Go package for speech recognition without network access, supporting Linux, macOS, Windows
★ 26Goupdated 2026-04-16
Fully local, private and cross platform Speech-to-Text with LLM Post-processing
★ 730TypeScriptupdated 2026-04-19asrasr-modeldebian-packageslinuxmacos
TalkType is a cross-platform application built with Electron, supporting Windows, macOS, and Linux. By combining Automatic Speech Recognition (ASR) with Large Language Models (LLM), it goes beyond simple dictation to offer "Understanding", "Polishing", and "Q&A" capabilities — your all-in-one voice writing assistant.
★ 5JavaScriptupdated 2026-03-01
A Linux first system-wide dictation tool to transcribe Speech To Text (STT) . Super accurate, fast, and free.
★ 7TypeScriptupdated 2026-04-15
Privacy-first voice dictation for Linux Wayland — press a key to talk, release to type. Powered by Whisper AI, 100% offline, no subscription required.
★ 11Pythonupdated 2026-04-03accessibilityappimagedictationgnomegtk
Wisper - Voice dictation app for Linux. Type directly at cursor with AI-powered transcription.
★ 8TypeScriptupdated 2026-02-14assistanthelpervoice-recognition
Voice typing for the Linux desktop.
★ 92Kotlinupdated 2026-04-19accessibilityasrdictationlinuxportals
Curated list of open-source speech-to-text and voice typing tools for Linux, macOS, Windows, Android, and iOS. Offline, local, and cloud.
★ 99updated 2026-04-12aiautomatic-speech-recognitionawesome-listdictationdictation-tool
Free, open-source, 100% offline voice dictation for Linux. Speak and type anywhere via whisper.cpp, Whisper & VOSK engines, GPU-accelerated, works on X11 + Wayland!
★ 281Pythonupdated 2026-04-20accessibilitydictationgpu-accelerationlinuxoffline-first
Fast, small, and fully autonomous AI personal assistant infrastructure, ANY OS, ANY PLATFORM — deploy anywhere, swap anything 🦀
★ 30,636Rustupdated 2026-04-20agentagenticaiinframl
Your personal intelligence agent. Watches the world from multiple data sources and pings you when something changes.
★ 9,087JavaScriptupdated 2026-04-03aiintelligenceosint
A production-oriented multi-agent orchestration framework.
★ 1,746Goupdated 2026-04-16agentaimulti-agent-systems
The agent that grows with you
★ 117,089Pythonupdated 2026-04-20aiai-agentai-agentsanthropicchatgpt
Give your AI agent eyes to see the entire internet. Read & search Twitter, Reddit, YouTube, GitHub, Bilibili, XiaoHongShu — one CLI, zero API fees.
★ 18,240Pythonupdated 2026-04-13agent-infrastructureai-agentai-searchautomationbilibili
The visual feedback tool for agents.
★ 3,475TypeScriptupdated 2026-03-25aidesigntoolsui
Agent harness built with LangChain and LangGraph. Equipped with a planning tool, a filesystem backend, and the ability to spawn subagents - well-equipped to handle complex agentic tasks.
★ 21,775Pythonupdated 2026-04-20aideepagentslangchainlanggraph
AI agent expert in PostgreSQL
★ 1,061TypeScriptupdated 2026-04-20agentaianthropicllmopenai
Token-efficient data serialization for LLM/AI. 50% fewer tokens than JSON, 93% better value/token. Rust, schema validation, LSP.
★ 65Rustupdated 2026-04-20ai-mlclicsvdata-formatjson-alternative
Curated most up-to-date list of AI Agent Frameworks
★ 29updated 2025-09-22
multilspy is a lsp client library in Python intended to be used to build applications around language servers.
★ 570Pythonupdated 2026-04-16aiai4codeartificial-intelligencecode-analysiscode-completion
Fully autonomous AI Agents system capable of performing complex penetration testing tasks
★ 15,657Goupdated 2026-04-16ai-agentsai-security-toolanthropicautonomous-agentsgolang
AI Agent Engineering Platform built on an Open Source TypeScript AI Agent Framework
★ 8,483TypeScriptupdated 2026-04-15agentsaiai-agentsai-agents-frameworkaiagentframework
Let AI agents browse the web. An autonomous toolkit for browser-based AI agents.
★ 9,407TypeScriptupdated 2026-04-02ai-agentsautomationclaudeplaywrightpuppeteer
Browser automation CLI for AI agents
★ 30,587Rustupdated 2026-04-20
Trade autonomously on Polymarket using AI Agents
★ 3,309Pythonupdated 2024-11-05
A curated list of amazingly awesome Modal applications, demos, and shiny things. Inspired by awesome-php.
★ 187updated 2025-12-29
Terminal UI for chatting with MiMo models through Xiaomi's OpenAI-compatible API
★ 1TypeScriptupdated 2026-03-22
Xiaomi Mimo TTS Custom Component for Home Assistant
★ 9Pythonupdated 2026-03-21
OpenClaw TTS Provider for Xiaomi MiMo (mimo-v2-tts)
★ 8Shellupdated 2026-03-22mimomimo-v2-ttsopenclaw-skillsttsxiaomi
Xiaomi Mi Air Purifier and Xiaomi Mi Air Humidifier integration for Home Assistant
★ 493Pythonupdated 2025-12-05airfreshairhumidifierairpurifiercustom-componentfan
Xiaomi Home Integration for Home Assistant
★ 21,635Pythonupdated 2026-01-28home-assistanthome-assistant-integrationmiotmiot-devicessmart-home
A unified tokenizer that is capable of both extracting semantic information and enabling high-fidelity audio reconstruction.
★ 140Pythonupdated 2025-09-19
MiMo-Audio: Audio Language Models are Few-Shot Learners
★ 1,029Pythonupdated 2026-03-03
MiMo-V2-Flash: Efficient Reasoning, Coding, and Agentic Foundation Model
★ 1,289updated 2026-01-08
MiMo: Unlocking the Reasoning Potential of Language Model – From Pretraining to Posttraining
★ 2,053Pythonupdated 2025-06-05
Multi-Agent Harness for Production AI
★ 10,141Pythonupdated 2026-04-20agentagent-frameworkagent-skillsanthropicautomation
🤖 AI Gateway | AI Native API Gateway
★ 8,263Goupdated 2026-04-24ai-gatewayai-nativeapi-gatewaycloud-nativeenvoy
The Cloud-Native API Gateway and AI Gateway
★ 16,513Luaupdated 2026-04-20apiapi-gatewayapi-managementapigatewayapis
★ 409Pythonupdated 2026-04-01
A Model Context Protocol (MCP) server implementation that provides database capabilities for Chroma
★ 541Pythonupdated 2025-09-17
Agent skills for working with Chroma
★ 15TypeScriptupdated 2026-04-14
Voice-driven mobile automation agent via on-device ADB
★ 3Kotlinupdated 2026-03-12
Open-source voice-first AI assistant for Android that actually controls your phone.
★ 12TypeScriptupdated 2026-03-27agentai-assistantandroidclaudedriving-code
Third-party Android app that lets you skip rollout queues & update your OPPO/OnePlus/realme device ASAP! Ensure your device is up-to-date — it's quick, easy, and free!
★ 672Kotlinupdated 2026-04-16androidcolorosfrontendhacktoberfestoneplus
★ 471Shellupdated 2022-08-31
Customize Oxygen OS
★ 440Javaupdated 2026-04-19
BCR-GUI is a companion app for the great BCR (Basic Call Recorder) Android application and other supported ROMs with embedded call recorders.
★ 289TypeScriptupdated 2026-03-09android-appangularcall-recordingcapacitorcapacitor-android
An Xposed module for adding beautiful lyrics to Spotify
★ 176Javaupdated 2026-04-18androidspotifyspotify-modxposedxposed-module
Discover best root apps, Magisk/ KernelSu & LSPosed(xposed) modules & rooting guides
★ 3,063JavaScriptupdated 2026-04-18androidandroid-appandroid-rootandroid-tweaksapatch
LSPosed Framework
★ 23,546Javaupdated 2025-03-04androidxposed
A collection of Model Context Protocol (MCP) servers, clients and developer tools by IBM.
★ 371updated 2026-04-17agentsllmmcpmodelcontextprotocoltoolcalling
Google 💚 MCP
★ 3,971updated 2026-03-27
Teams-first Multi-agent orchestration for Claude Code
★ 31,324TypeScriptupdated 2026-04-20agentic-codingai-agentsautomationclaudeclaude-code
OpenViking is an open-source context database designed specifically for AI Agents(such as openclaw). OpenViking unifies the management of context (memory, resources, and skills) that Agents need through a file system paradigm, enabling hierarchical context delivery and self-evolving.
★ 23,068Pythonupdated 2026-04-20agentagentic-ragai-agentsclawbotcontext-database
Automate the process of making money online.
★ 30,225Pythonupdated 2026-04-04automationclijsonmoneyoutreach
Create and share 3D architectural projects.
★ 14,375TypeScriptupdated 2026-04-17
Give Claude Code a subconscious
★ 2,677TypeScriptupdated 2026-04-16
The memory-first coding agent
★ 2,367TypeScriptupdated 2026-04-20
Open-source AI hackers to find and fix your app’s vulnerabilities.
★ 24,581Pythonupdated 2026-04-16agentsartificial-intelligencecybersecuritygenerative-aillm
π RuView: WiFi DensePose turns commodity WiFi signals into real-time human pose estimation, vital sign monitoring, and presence detection — all without a single pixel of video.
★ 50,293Rustupdated 2026-04-20agentic-aidenseposeesp32firmwaremcu
Fast computer automation CLI for AI agents. Control any desktop with screenshots, clicks, typing, scrolling, and more.
★ 273Zigupdated 2026-04-07
Autumn is an open-source pricing & billing platform
★ 2,507TypeScriptupdated 2026-04-20
SDK, skills, and examples for Inkbox: give your AI agents identities, inboxes, phone numbers, and encrypted vaults.
★ 9TypeScriptupdated 2026-04-17agent-communicationagent-infrastructureagent-toolsai-agentsai-infrastructure
An index of prompting libraries for GPTs, including ChatGPT. Some of these are on Github and others are hosted externally.
★ 1updated 2024-11-21
interactive terminal interface for discovering, previewing, and managing Claude Code configuration files and slash commands.
★ 1updated 2026-03-16
Algorithmic trading and quantitative trading open source platform to develop trading robots (stock markets, forex, crypto, bitcoins, and options).
★ 9,787C#updated 2026-04-19algorithmic-tradingalgorithmic-trading-enginebacktestingbitcoinsbroker
An AI assistant that lives in your browser. Built for collaboration, not autonomy theater. You guide, it executes. Automate repetitive web tasks, extract data from any website, and transform it into whatever you need.
★ 1updated 2026-03-25
AI coding workstation: Claude Code + web UI + 7 AI CLIs + headless browser + 50+ tools
★ 2,068Dockerfileupdated 2026-04-10aiai-codinganthropicclaudeclaude-code
This API provides programmatic access to the AlphaGenome model developed by Google DeepMind.
★ 1,889Pythonupdated 2026-03-18
Beads - A memory upgrade for your coding agent
★ 21,402Goupdated 2026-04-19agentsclaude-codecoding
A terminal workspace with batteries included
★ 31,933Rustupdated 2026-04-17multiplexerterminalworkspace
A Telegram bot that monitors Israeli Home Front Command (Pikud HaOref) alerts for specific user-selected cities with notifications in selected language. Designed to keep family members abroad informed in real-time if I’m in a bomb shelter and unable to reach out.
★ 1JavaScriptupdated 2026-04-08
Standalone ESP32-C3 device that monitors Pikud HaOref alerts in real time — NeoPixel LED strip + MAX7219 matrix display, no Home Assistant required
★ 1C++updated 2026-03-23
MagicMirror² module for Israeli missile alerts (Tzeva Adom / צבע אדום) via the official Pikud HaOref API
★ 1JavaScriptupdated 2026-04-01
Live alert tracker for Pikud HaOref (Israel Home Front Command) — CLI tool and web dashboard
★ 1HTMLupdated 2026-03-01
Visual alert indicator for the Israeli Home Front Command (Pikud HaOref) Red Alert system, built for Raspberry Pi Zero with a WS2812B (NeoPixel) LED strip.
★ 6Pythonupdated 2026-03-19alarmalertledspython3raspberry-pi
A Claude Code status line for Pikud Haoref red alerts
★ 5Shellupdated 2026-03-23
Real-time Pikud HaOref (Israeli Home Front Command) rocket alert notifications directly in your Claude Code status line.
★ 4Shellupdated 2026-03-05
Real-time Pikud HaOref (Home Front Command) siren monitor for Windows
★ 3JavaScriptupdated 2026-04-07aidhearinghomehome-frontisrael
Homebridge plugin for Pikud HaOref (Israel Home Front Command) real-time alerts as HomeKit motion sensors
★ 1JavaScriptupdated 2026-03-14
Pikud HaOref rocket alert phone call service - monitors Israeli Home Front Command alerts and calls your phone via Twilio
★ 5Pythonupdated 2026-03-25
★ 1Pythonupdated 2026-03-13
Claude Code plugin with skills for building integrations with Israel's Pikud HaOref (Home Front Command) alert system — rocket alerts, earthquake warnings, and civil defense notifications.
★ 2updated 2026-03-07alertscivil-defenceclaude-code-marketplaceclaude-code-pluginhome-front-command
Live Pikud HaOref alerts on interactive Israeli map with LIVE, History Region, and Reports tabs
★ 1JavaScriptupdated 2026-03-01
Automatically triggers your Roborock vacuum whenever Pikud HaOref issues a missile alert for your area
★ 7Pythonupdated 2026-03-01
This GraphQL API provides access to alerts data related to Pikud HaOref red alerts history.
★ 5TypeScriptupdated 2026-03-30
Raspberry Pi × Pikud HaOref — monitors Israeli Home Front Command alerts and drives an RGB LED
★ 6Pythonupdated 2026-03-11
Live map of Israel Home Front Command alerts
★ 24JavaScriptupdated 2026-04-19
Groq MCP server
★ 42Pythonupdated 2025-11-19managed-by-terraform
Project N.O.M.A.D, is a self-contained, offline survival computer packed with critical tools, knowledge, and AI to keep you informed and empowered—anytime, anywhere.
★ 24,916TypeScriptupdated 2026-04-18
Claude Code tmux orchestration — spawn full AI sessions as parallel workers with heartbeat monitoring and file-based coordination
★ 25Shellupdated 2026-04-06ai-agentsautomationclaude-codedeveloper-toolsmcp
List of libraries, tools and APIs for web scraping and data processing.
★ 7,855Makefileupdated 2026-04-17captcha-bypasscaptcha-recaptchacrawlercrawlingcrawling-framework
A Chrome DevTools Protocol driver for web automation and scraping.
★ 6,883Goupdated 2026-02-17automationcdpchrome-devtoolschrome-devtools-protocolchrome-headless
jsoup: the Java HTML parser, built for HTML editing, cleaning, scraping, and XSS safety.
★ 11,362Javaupdated 2026-04-20csscss-selectorsdomhtmljava
🌐 The open-source Agentic browser; alternative to ChatGPT Atlas, Perplexity Comet, Dia.
★ 10,648TypeScriptupdated 2026-04-19agentbrowserbrowseroschromiumhacktoberfest
A fast, helpful, and open-source document parser
★ 4,840TypeScriptupdated 2026-04-17document-ocrdocument-processingocrocr-recognitionpdf
Tuta is an email service with a strong focus on security and privacy that lets you encrypt emails, contacts and calendar entries on all your devices.
★ 7,521TypeScriptupdated 2026-04-20emailencryptionjavascriptmithrilprivacy
Fully autonomous & self-evolving research from idea to paper. Chat an Idea. Get a Paper. 🦞
★ 11,636Pythonupdated 2026-04-10autonomous-researchcitation-verificationllm-agentsmetaclawmulti-agent-debate
Use your Claude Max subscription with OpenCode, Pi, Droid, Aider, Crush, Cline. Proxy that bridges Anthropic's official SDK to enable Claude Max in third-party tools.
★ 952TypeScriptupdated 2026-04-20ai-codingaideranthropicbuncharmbracelet
The new Windows Terminal and the original Windows console host, all in the same place!
★ 102,910C++updated 2026-04-19cmdcommand-lineconsolecontributions-welcomegood-first-issue
A tool for extracting contents (assemblies, configuration, etc.) from a single-file application to a directory, suitable for purposes like malware analysis.
★ 158C#updated 2025-03-05dotnetmalwaremalware-analysisreverse-engineeringtooling
Packages for Typst.
★ 948Rustupdated 2026-04-20
A Simple and Universal Swarm Intelligence Engine, Predicting Anything. 简洁通用的群体智能引擎,预测万物
★ 57,398Pythonupdated 2026-04-02agent-memoryfinancial-forecastingfuture-predictionknowledge-graphllms
1Password MCP server used for storing passwords create separate vault please
★ 12TypeScriptupdated 2026-03-161password1password-integrationmcp
The best ChatGPT that $100 can buy.
★ 52,514Pythonupdated 2026-04-14
AI agents running research on single-GPU nanochat training automatically
★ 76,655Pythonupdated 2026-03-26
Android application for data transfer, using sound waves
★ 32Javaupdated 2025-04-19android-developmentdata-transferfrequency-modulationjavasound
Tiny data-over-sound library
★ 7,626C++updated 2026-04-16arduinodata-over-soundeccfskinternet-of-things
מעקב אזעקות פיקוד העורף - 24 שעות
★ 1JavaScriptupdated 2026-03-05
מערכת ניטור התראות פיקוד העורף בזמן אמת — ייצוא Excel
★ 1Pythonupdated 2026-03-26
Basic HomeAssistant blueprints for the HACS Oref Alerts repository, that do things upon safe/unsafe
★ 1updated 2026-03-09
a multi-modal MCP layer for real life — built on continuous video, semantic search and natural language video understanding.
★ 9Pythonupdated 2025-09-03
ProtOSINT is a Python script that helps you investigate Protonmail accounts and ProtonVPN IP addresses
★ 408Pythonupdated 2025-08-07
Spyder OSINT GUI — Graphical open-source intelligence research tool for phone number lookup, IP geolocation, social media reconnaissance, email validation, domain WHOIS, username search, with multi-module architecture and Tkinter-based interface for digital forensics
★ 341Pythonupdated 2026-03-13digital-forensicsdomain-lookupemail-osintinformation-gatheringip-lookup
Open-source intelligence for the global theater. Track everything from the corporate/private jets of the wealthy, and spy satellites, to seismic events in one unified interface. The knowledge is available to all but rarely aggregated in the open, until now.
★ 5,499TypeScriptupdated 2026-04-04air-force-oneairforce1asdbcctvcctv-cameras
Very low latency speech to text, intent recognition, and text to speech, for building voice agents and interfaces
★ 7,857Cupdated 2026-04-20intent-recognitionsttttsvoicevoice-recognition
Google Workspace CLI — one command-line tool for Drive, Gmail, Calendar, Sheets, Docs, Chat, Admin, and more. Dynamically built from Google Discovery Service. Includes AI agent skills.
★ 25,395Rustupdated 2026-04-20agent-skillsai-agentautomationclidiscovery-api
Mobile Git client for syncing a repository between remote and a local directory
★ 1,697Dartupdated 2026-04-19gitobsidianproductivitysync
Grok-Desktop is an Electron based desktop application for Windows 11 that wraps `grok.com`, allowing local access to Grok with support for xAI, Google, and Apple authentication.
★ 112HTMLupdated 2026-02-07ai-assistantchatdebianelectrongrok-desktop
Autonomous AI development loop for Claude Code with intelligent exit detection
★ 8,853Shellupdated 2026-04-13aiai-agentai-agentsai-developmentai-development-tools
An improved implementation of the Ralph Wiggum technique for autonomous AI agent orchestration
★ 2,759Rustupdated 2026-04-18aiai-agentsai-agents-frameworkai-developer-toolsclaude-code
A curated list of resources about Ralph, the AI coding technique that runs AI coding agents in automated loops until specifications are fulfilled.
★ 862updated 2026-02-03ai-codingclaudeclaude-coderalphralph-loop
The agent harness performance optimization system. Skills, instincts, memory, security, and research-first development for Claude Code, Codex, Opencode, Cursor and beyond.
★ 167,109JavaScriptupdated 2026-04-19ai-agentsanthropicclaudeclaude-codedeveloper-tools
Voice calling and SMS for Clawdbot
★ 169Shellupdated 2026-03-06
A clean web dashboard for OpenClaw. Connect your Gateway, manage agents, and ship faster. ⭐️ Star if you like it!
★ 1,986TypeScriptupdated 2026-03-19
Run OpenClaw, (formerly Moltbot, formerly Clawdbot) on Cloudflare Workers
★ 9,862TypeScriptupdated 2026-04-17ai-agentscloudflare-workers
A community collection of OpenClaw use cases for making life easier.
★ 30,237updated 2026-03-24awesome-listclawdbotmoltbotopenclawopenclaw-plugin
The awesome collection of OpenClaw skills. 5,400+ skills filtered and categorized from the official OpenClaw Skills Registry.🦞
★ 47,241updated 2026-04-20agent-skillsawesomeawesome-listawesome-listsclawd
SuperWhisper-like voice dictation for Linux with waveform UI
★ 32Pythonupdated 2026-01-22
Enables and automates ACME (Let’s Encrypt-compatible) certificate issuance and renewal on GL.iNet (OpenWrt-based) routers via a simple shell script.
★ 105Shellupdated 2026-04-16glinetopenwrt
Home Assistant custom component for GL.iNet routers running 4.X firmware.
★ 83Pythonupdated 2026-04-14glinethomeassistanthomeassistant-custom-componentopenwrt
Python3 GL-Inet client for json-rpc
★ 28Pythonupdated 2025-10-12apiaxt-1800gl-inetglinetjson-rpc
This is a Model Context Protocol (MCP) server built with TypeScript. It provides a versatile tool to fetch and parse any standard RSS/Atom feed, and also includes special support for RSSHub feeds.
★ 31TypeScriptupdated 2025-12-12
⭐AI-driven public opinion & trend monitor with multi-platform aggregation, RSS, and smart alerts.🎯 告别信息过载,你的 AI 舆情监控助手与热点筛选工具!聚合多平台热点 + RSS 订阅,支持关键词精准筛选。AI 智能筛选新闻 + AI 翻译 + AI 分析简报直推手机,也支持接入 MCP 架构,赋能 AI 自然语言对话分析、情感洞察与趋势预测等。支持 Docker ,数据本地/云端自持。集成微信/飞书/钉钉/Telegram/邮件/ntfy/bark/slack 等渠道智能推送。
★ 55,242Pythonupdated 2026-04-18aibarkdata-analysisdockerhot-news
100+ tool MCP server for real-time global intelligence — markets, FX, bonds, earnings, SEC filings, conflict, military, cyber, climate, news, company enrichment, and 30+ domains. Live Leaflet dashboard with 20 map layers, SSE streaming, and AI situation briefs.
★ 23Pythonupdated 2026-04-06ai-toolsai-watchanthropicclaudecybersecurity
Play videos side-by-side
★ 1,907Pythonupdated 2026-01-13libvlclivestreamplayerplayer-videopyqt
A curated list of resources related to IPTV
★ 10,979updated 2026-04-19epgiptvplayerstv
:tv: Cross-platform IPTV player application with multiple features, such as support of m3u and m3u8 playlists, favorites, TV guide, TV archive/catchup and more.
★ 5,899TypeScriptupdated 2026-04-19chromeoselectronepgfair-sourceiptv
M3U Playlist for free TV channels
★ 15,962Pythonupdated 2026-04-09help-wantedlooking-for-contributors
Multi-channel Web Stream Viewer
★ 24Vueupdated 2021-10-12
Play multiple live videos simultaneously in a grid
★ 15TypeScriptupdated 2025-12-14gridlivemultiplayerstream
Display a mosaic of livestreams. Built for streaming.
★ 282TypeScriptupdated 2026-02-02facebookinstagramlivestreammultistreamperiscope
State machines, statecharts, and actors for complex logic
★ 29,516TypeScriptupdated 2026-04-18background-jobsfinite-state-machinefsmhacktoberfestinterpreter
React component for building interactive diagrams.
★ 652TypeScriptupdated 2026-01-04dagflowchartreactx6
JavaScript diagramming library for interactive flowcharts, org charts, design tools, planning tools, visual languages.
★ 8,421HTMLupdated 2026-04-07canvaschartchartsdata-visualizationdiagram
Draws simple SVG flow chart diagrams from textual representation of the diagram
★ 8,693JavaScriptupdated 2026-01-15diagramflowchartjavascriptsvg
squirrel-foundation is a State Machine library, which provided a lightweight, easy use, type safe and programmable state machine implementation for Java.
★ 2,253Javaupdated 2024-06-04event-handlersfsmjavastate-machinestatemachine
Get Aliexpress product details as a json response including feedbacks, variants, shipping info, description, images, etc.,
★ 281JavaScriptupdated 2026-04-17aliexpressaliexpress-apialiexpress-crawleraliexpress-product-jsonaliexpress-product-scraper
Private, cross-platform package tracking app
★ 357Dartupdated 2026-01-27androidfreedom-tracking-applinuxmail-trackingpackage-tracking
📦 Track all your parcels with ease.
★ 236Kotlinupdated 2026-04-11androidjavajetpack-composekotlinmobile
Control Claude Code from your iPhone or iPad — Tactic Remote
★ 11updated 2026-04-13claude-codeiosmacosremote-controlssh
Ground Station is all-in-one satellite monitoring suite
★ 4,231JavaScriptupdated 2026-04-20antennabpskfftfskground-station
An AI agent for teams, communities, and multi-user environments.
★ 2,148Rustupdated 2026-04-20agentagenticaiautomationdeveloper-tools
A collaboratively curated list of awesome Open-Source Intelligence (OSINT) Resources
★ 2,332updated 2025-06-26awesomeawesome-intelligenceawesome-listawesome-listscrypto
The ArDrive Command Line Interface (CLI) is a Node.js application for terminal-based ArDrive workflows. It also offers utility operations for securely interacting with Arweave wallets and inspecting various Arweave blockchain conditions.
★ 96TypeScriptupdated 2026-02-26
The ArDrive App allows a user to log in to securely view, upload and manage their ArDrive files with their browser or mobile phone.
★ 70Dartupdated 2026-04-07arweavedartflutter
Build, run and scale AI agents like API and microservices - observable,auditable and identity-aware from day one.
★ 1,476Goupdated 2026-04-18agentagent-authagent-authenticationagent-indentityagent-scaling
MVT (Mobile Verification Toolkit) helps with conducting forensics of mobile devices in order to find signs of a potential compromise.
★ 12,346Pythonupdated 2026-04-13androidforensicsforensics-toolsiosmobile
A dynamic NewsAI dashboard that uses NLP to analyze news articles, visualize sentiment trends, and extract insights through interactive data visualizations.
★ 38Pythonupdated 2026-04-03data-visualizationhacktoberfesthacktoberfest-acceptednewsaggnewsapi
Real-time global intelligence dashboard. AI-powered news aggregation, geopolitical monitoring, and infrastructure tracking in a unified situational awareness interface
★ 52,633TypeScriptupdated 2026-04-20aidashboardgeopoliticsmonitoringnews
★ 709TeXupdated 2026-03-20
SatIntel is an OSINT tool for Satellites 🛰. Extract satellite telemetry, receive orbital predictions, and parse TLEs 🔭
★ 883Goupdated 2024-03-15aerospacecybersecuritygolangorbital-dynamicsosint
A set of tools to trim, crop and select frames inside a video
★ 908Swiftupdated 2024-12-11cropcroppingiosswiftthumbnail
A dead simple tool to sign files and verify digital signatures.
★ 2,719Cupdated 2026-01-14cryptocryptographyed25519gpgpgp
Digital Signature Service : creation, extension and validation of advanced electronic signatures
★ 985Javaupdated 2026-04-18asiccadesesignaturejadesjava
An Extensive AI & Camera Metadata Viewer
★ 68TypeScriptupdated 2026-04-14automatic1111comfyui-workflowdatasetexif-metadataflux
Metadata-indexer and Viewer for AI-generated images
★ 987C#updated 2026-02-27csharpdotnetimage-indexingimage-viewerpnginfo
Extracts Exif, IPTC, XMP, ICC and other metadata from image, video and audio files
★ 2,776Javaupdated 2026-04-20epsexificciptcjava
The Bagger application packages data files according to the BagIt specification.
★ 139Javaupdated 2023-01-09
AI-aware code governance with cryptographically verifiable evidence bundles
★ 4Pythonupdated 2026-04-19
An open-source framework for detecting, redacting, masking, and anonymizing sensitive data (PII) across text, images, and structured data. Supports NLP, pattern matching, and customizable pipelines.
★ 7,806Pythonupdated 2026-04-20anonymizationdata-anonymizationdata-maskingdata-obfuscationdata-privacy
⭐️ A curated list of awesome forensic analysis tools and resources
★ 5,021updated 2026-04-12computer-forensicsdfirdigital-forensicsforensic-analysisfree
A list of free and open forensics analysis tools and other resources
★ 2,229updated 2025-04-20awesome-listcomputer-foredigital-forensicsforensic-analysisforensic-tools
Metasploit Framework
★ 38,030Rubyupdated 2026-04-20hacktoberfest
Comprehensive guide to AI applications in OSINT workflows and intelligence analysis
★ 53updated 2025-07-14ai-toolsartificial-intelligenceautomated-analysiscomputer-visiondata-analysis
Digital Forensics Guide. Learn all about Digital Forensics, Computer Forensics, Mobile device Forensics, Network Forensics, and Database Forensics.
★ 2,581Pythonupdated 2024-01-04alertingcyber-securitydetection-engineeringdfirdigital-forensics
Information gathering framework for phone numbers
★ 16,305Goupdated 2026-01-06agregationfootprintinformation-gatheringinvestigationopen-source-intelligence
List of Github repositories and articles with list of dorks for different search engines
★ 2,608updated 2025-04-11awesomeawesome-listcybersecurityhackingosint
AI tools for OSINT
★ 126updated 2026-04-05aiartificial-intelligencechatgptchatgpt-apigemini
Emora is an OSINT tool like sherlock but with a GUI, which search for accounts by username across social networks
★ 688C#updated 2026-02-07analysisautomationcsharpcybersecuritydiscovery
Open Cyber Threat Intelligence Platform
★ 9,193TypeScriptupdated 2026-04-20cticybercybersecurityintelligenceosint
ClatScope Info Tool – The best and most versatile OSINT utility for retrieving geolocation, DNS, WHOIS, phone, email, data breach information and much more (70+ features). Perfect for investigators, pentesters, or anyone looking for an effective reconnaissance / OSINT tool.
★ 1,448Pythonupdated 2025-11-19intelligenceinvestigationosintosint-pythonosint-reconnaissance
OSINT tool to crawl a site and extract useful recon info.
★ 462Pythonupdated 2025-08-13
Fast passive subdomain enumeration tool.
★ 13,501Goupdated 2026-04-20bugbountyhackinghacktoberfestosintreconnaissance
MCP server exposing multiple OSINT tools for AI assistants like Claude
★ 195Pythonupdated 2025-08-07aiclaudeholeheintelligence-gatheringinvestigation
A modern platform for visual, flexible, and extensible graph-based investigations. For cybersecurity analysts and investigators.
★ 3,288TypeScriptupdated 2026-04-19investigationosintpythonrecon
A list of articles, videos, and tools related to the use of AI for OSINT.
★ 367updated 2026-03-24aiawesome-listchrome-extensionsintelligenceosint
GeoIntel using Google's Gemini API to uncover the location where photos were taken through AI-powered geo-location analysis.
★ 1,035HTMLupdated 2026-03-09geolocationimageosint
Popular OSINT framework for online investigations.
★ 300Shellupdated 2024-11-13anonymous-functionsosintosint-frameworkosint-reconnaissanceosint-tool
A multi-purpose OSINT toolkit with a neat web-interface.
★ 800Goupdated 2024-08-05badgerdbemail-osintgithub-osintgo-osint-toolgolang
GHOST - Global Human Operations & Surveillance Tracking: Open-source investigation management platform for tracking people, connections, and intelligence data. Because Excel spreadsheets are for accountants, not investigators. Non-commercial license.
★ 373JavaScriptupdated 2026-01-29investigationosintosint-tool
The fastest and complete solution for domain recognition. Supports screenshoting, port scan, HTTP check, data import from other tools, subdomain monitoring, alerts via Discord, Slack and Telegram, multiple API Keys for sources and much more.
★ 3,724Rustupdated 2026-04-14bugbountydnsosintsubdomains
Browser Chrome extensions, to help with OSINT, OPSEC, Privacy & Obfuscation.
★ 410updated 2025-11-09obfuscationopsecosintprivacytechniques
A query aggregator for OSINT based threat hunting
★ 938Rubyupdated 2026-03-07osintthreat-huntingthreat-intelligence
Poastal - the Email OSINT tool
★ 598Pythonupdated 2024-04-08emailosintpythonrecon
Trace Labs OSINT VM
★ 636Shellupdated 2026-04-13
An OSINT tool for gathering information about phone numbers
★ 644Pythonupdated 2025-10-21
Semi-automatic OSINT framework and package manager
★ 2,430Rustupdated 2025-01-31bug-bountycertificate-transparencyintelligenceinvestigationlocation
A browser extension for OSINT search
★ 1,772TypeScriptupdated 2026-04-13chrome-extensionosintsecuritythreat-intelligence
🕵️‍♂️ Offensive Google framework.
★ 18,750Pythonupdated 2026-04-10googlehideandsecosint
List of API's for gathering information about phone numbers, addresses, domains etc
★ 2,275updated 2025-05-16apiapi-restawesomeawesome-listcybersecurity
Content Authenticity Security Tool
★ 12Rustupdated 2026-04-07
Verify the authenticity of handwritten signatures through digital image processing and neural networks. ✍️
★ 209Pythonupdated 2022-11-12handwritten-signaturesneural-networkopencvsignature-recognitionsignature-verification
OSINT tools for Information gathering, Cybersecurity, Reverse searching, bugbounty, trust and safety, red team oprations and more.
★ 3,188Shellupdated 2026-04-20blue-teambugbountyinformation-gatheringosintosint-tools
A program for extracting hard coded (burned in) subtitle from a video and generating an external subtitle.
★ 70Pythonupdated 2026-03-21chineseocrhardsubocrocr-pythonsrt
Uses VideoSubFinder and Google Cloud Vision to extract hardsubs and OCR them to create an SRT file. Archive of files at https://github.com/Furretar/Mandarin-Subtitles-Archive.
★ 19Pythonupdated 2026-02-09
🎦 Extract video hard subtitles and automatically generate corresponding srt files.
★ 498Pythonupdated 2025-09-11ocrrapid-videocrsubtitlevideovideosubfinder
Extract hardcoded subtitles from videos using machine learning
★ 547Pythonupdated 2024-01-30
视频硬字幕提取,生成srt文件。无需申请第三方API,本地实现文本识别。基于深度学习的视频字幕提取框架,包含字幕区域检测、字幕内容提取。A GUI tool for extracting hard-coded subtitle (hardsub) from videos and generating srt files.
★ 8,695Pythonupdated 2026-04-09deep-learningextracthardsubocrripper
★ 150HTMLupdated 2026-04-07
gmail backup software
★ 3,637Pythonupdated 2022-05-01backupgmailgmvaultoauth2python
Your own personal AI assistant. Any OS. Any Platform. The lobster way. 🦞
★ 364,025TypeScriptupdated 2026-04-20aiassistantcrustaceanmoltyopenclaw
Python binding for c2pa-rs library
★ 76Pythonupdated 2026-04-17
Grive Tools - Ubuntu Google Drive desktop integration (custom packaging)
★ 3Pythonupdated 2025-01-06
Web GUI for rclone rc.
★ 120TypeScriptupdated 2026-01-02rclonerclone-gui
RClone Manager is a cross-platform GUI application designed to help users manage Rclone remotes efficiently.
★ 835TypeScriptupdated 2026-04-18adwaitaangularangular-materialdocker-imagedropbox
Java client library for the Google Photos Library API
★ 120Javaupdated 2023-10-17googlegoogle-photosjava
Script that organizes the Google Takeout archive into one big chronological folder
★ 5,668Dartupdated 2025-01-29exifexif-datagoogle-photosgoogle-takeoutjson
Rclone desktop app
★ 594TypeScriptupdated 2025-12-22electronelectron-apprclonerclone-clientrclone-gui
The cross-platform GUI for rclone & S3.
★ 1,911TypeScriptupdated 2026-03-31backblaze-b2cyberduckdropboxftpfuse
The "Third Way" for Home Assistant Automations.
★ 1,472TypeScriptupdated 2026-03-07hacshome-assistant
Qwen3-TTS is an open-source series of TTS models developed by the Qwen team at Alibaba Cloud, supporting stable, expressive, and streaming speech generation, free-form voice design, and vivid voice cloning.
★ 10,962Pythonupdated 2026-03-17
Gas Town - multi-agent workspace manager
★ 14,643Goupdated 2026-04-20
Public mirror of the Windscribe VPN desktop client for Windows, Mac and Linux
★ 933C++updated 2026-04-14
The most advanced free and open-source browser fingerprinting library
★ 26,991TypeScriptupdated 2026-04-14audio-fingerprintingbrowserbrowser-fingerprintbrowser-fingerprintingdetection
Accurately Locate Smartphones using Social Engineering
★ 9,289CSSupdated 2025-05-07accuracyaltitudegeolocationlatitudelongitude
Welcome to DarkWebEye Explore the unseen depths of the internet with DarkWebEye, a powerful and intuitive tool crafted by Jolanda de Koff. Designed for ethical hackers, cybersecurity enthusiasts, and researchers, DarkWebEye offers a secure and efficient way to search the dark web through the Ahmia search engine.
★ 56Pythonupdated 2026-04-09
Overture Maps Data
★ 1,130Pythonupdated 2026-04-20
Gets the list of Mullvad servers with the best latency according to ping
★ 84TypeScriptupdated 2025-11-23denomullvadpingvpn
Determines the Mullvad server with the lowest latency
★ 60Goupdated 2023-10-10golatencymullvadvpn
VPN client in a thin Docker container for multiple VPN providers, written in Go, and using OpenVPN or Wireguard, DNS over TLS, with a few proxy servers built-in.
★ 13,947Goupdated 2026-04-19alpinecyberghostdns-over-tlsdockergolang
Run applications through VPN tunnels with temporary network namespaces
★ 1,208Rustupdated 2026-04-18hacktoberfestmullvadopenvpnrustrust-lang
OpenTimestamps client
★ 390Pythonupdated 2026-02-07bitcoincryptographyopentimestampstimestamp
iOS ProofMode app with Web3 wallet integration - Enhanced fork of https://gitlab.com/guardianproject/proofmode/proofmode-ios/-/commit/b51eba33
★ 1Swiftupdated 2025-09-15
Work with BagIt packages from Python.
★ 260Pythonupdated 2026-04-08
A collection of Awesome Google Dorks.
★ 661updated 2024-07-01
IPED Digital Forensic Tool. It is an open source software that can be used to process and analyze digital evidence, often seized at crime scenes by law enforcement or in a corporate investigation by private examiners.
★ 2,523Javaupdated 2026-04-13digital-forensicsforensicrecovery
A Complete Osint Tool :mag:
★ 3,315Pythonupdated 2026-02-21geolocationinformation-gatheringkali-linuxlinuxmacos
AI-Powered Dark Web OSINT Tool
★ 4,883Pythonupdated 2026-03-31ai-tooldarkwebdarkweb-osintinvestigation-toolllm-powered
Go Library (w/ structures) to grab data from a Ubiquiti UniFi Controller
★ 144Goupdated 2026-04-14go-modulesgo-unifiunifi-apiunifi-controllerunifi-poller
UniFi Network Application - Home Assistant Community Apps
★ 366Dockerfileupdated 2026-04-15addonaddonsappshome-assistanthome-assistant-apps
UniFi Common - on_boot.d
★ 4,315Shellupdated 2026-04-03
The new emerging Non Linear Video Editor for Linux. Backup of Lumiera master repository
★ 15C++updated 2026-04-19
OpenShot Video Editor is an award-winning free and open-source video editor for Linux, Mac, and Windows, and is dedicated to delivering high quality video editing and animation solutions to the world.
★ 5,695Pythonupdated 2026-04-18c-plus-plusffmpeggplv3openshotpython
iperf3: A TCP, UDP, and SCTP network bandwidth measurement tool
★ 8,432Cupdated 2026-04-14iperf3
An open source script tests VPN connection for DNS Leak.
★ 575Shellupdated 2024-03-07dnsdns-serverleak-detectionsecurityvpn
Runs Speedtest through multiple Wireguard configs to determine fastest gateway. Tested with Mullvad
★ 5Shellupdated 2025-07-24
Find the best Mullvad VPN server to connect to
★ 19Goupdated 2025-12-29benchmarklatencymullvadmullvad-vpnserver
A curated list of WireGuard tools, projects, and resources.
★ 1,413updated 2024-09-04awesomeawesome-listcurated-listmesh-networkvpn
The easiest way to run WireGuard VPN + Web-based Admin UI.
★ 25,475TypeScriptupdated 2026-04-20
✔️ WireGuard-Manager is an innovative tool designed to streamline the deployment and management of WireGuard VPNs. Emphasizing user-friendliness and security, it simplifies the complexities of VPN configuration, offering a robust yet accessible solution for both personal and professional use.
★ 1,854Shellupdated 2025-12-15censorshipcensorship-circumventionencryptiongfwlinux
WireGuard road warrior installer for Ubuntu, Debian, AlmaLinux, Rocky Linux, CentOS and Fedora
★ 4,845Shellupdated 2026-04-17almalinuxbashcentosdebianfedora
WireGuard VPN installer for Linux servers
★ 10,838Shellupdated 2025-12-25linuxnatprivacyvpnwireguard
Wireguard web interface
★ 5,074Goupdated 2024-08-09wireguardwireguard-adminwireguard-config-genwireguard-gowireguard-ui
Keepalived
★ 4,544Cupdated 2025-11-03bfdcdaemonhigh-availabilityinfrastructure
gets weather forecast xml from ims.gov.il and parses it into rust structs / json
★ 8Rustupdated 2026-03-11androidandroid-appautomatecicli
Random digital audio effects
★ 4,339Cupdated 2026-02-26
THIS REPOSITORY IS MIRROR OF: https://gitlab.com/guardianproject/proofmode/proofmode-android
★ 253Kotlinupdated 2026-04-09
A curated list of OSINT MCP servers. Pull requests are welcomed!
★ 210updated 2026-04-19awesomeawesome-listawesome-listsmcpmcp-server
weatheril is an unofficial [IMS](https://ims.gov.il) (Israel Meteorological Service) python API wrapper.
★ 16Pythonupdated 2026-02-04apiforcastingimspython3weather
★ 20Rustupdated 2025-04-14
Autonomous Task Orchestration Manager for AI systems
★ 165updated 2023-04-25
A curated list of awesome Claude Skills, resources, and tools for customizing Claude AI workflows — particularly Claude Code
★ 11,761updated 2026-03-16agentic-codinganthropicawesomeawesome-listawesome-lists
generate release PRs based on the conventionalcommits.org spec
★ 6,791TypeScriptupdated 2026-04-13
Curated list of services and platforms for serverless GPU and AI inference
★ 45updated 2025-03-26aigpuserverless
the terminal client for Ollama
★ 2,360Pythonupdated 2025-12-19llmllmsmachine-learningollamapython
An utility that creates preset files for some EQ Vst Plugins based on Room EQ Wizard analysis.
★ 18C#updated 2024-11-08
The best way to use AI is on your own computer. Use local or paid API models, and ctrl+k to show/hide the chat UI. Experience the future of AI, and help build it too!
★ 424Pythonupdated 2025-04-16aichatgptclaudedeepseekhotkeys
A highly customizable, lightweight, and open-source coding CLI powered by Groq for instant iteration.
★ 725TypeScriptupdated 2025-12-19managed-by-terraform
Search your codebase with natural language • CLI • No data leaves your computer
★ 397Pythonupdated 2023-05-14aicodesearch
Weave your codebase into a single, navigable Markdown document
★ 738Goupdated 2025-12-04aiclicli-appcursor
CodeMachine is an open-source tool that orchestrates AI coding agents into repeatable, long-running workflows. ⚡️
★ 2,447TypeScriptupdated 2026-02-25aiautomationclicli-toolcode-generation
Cougar CLI - An AI programming agent for the command line
★ 1,202TypeScriptupdated 2026-01-02agentclicoding
🧬 Generate visual charts using ECharts with AI MCP dynamically, used for chart generation and data analysis.
★ 227TypeScriptupdated 2026-01-30echartsllmmcpmcp-server
an easy-to-use dynamic service discovery, configuration and service management platform for building AI cloud native applications.
★ 32,903Javaupdated 2026-04-20a2a-registryagentai-registryconfiguration-managementdistributed-configuration
The coloured icons library is a collection of brand logos and tech stack logos. It's a handy resource to easily add brand icons to your projects without the hassle of manual attribution.
★ 314CSSupdated 2026-03-21brand-iconcoding-iconcoding-iconscolor-iconscolored-icons
SVG icons for popular brands
★ 24,994JavaScriptupdated 2026-04-19brandbrand-assetsbrand-colorsbrandingbranding-assets
A Node.js library for Voice Activity Detection using the Silero VAD model.
★ 17TypeScriptupdated 2026-04-13
This project aims to provide clean, unified, reproducible prediction results for a wide set of VAD models across popular benchmarks.
★ 1updated 2025-12-14
A curated list of voice AI agent frameworks, tools, resources, and best practices
★ 25updated 2026-04-06agentsrealtime-chatsttttsvad
A curated list of awesome voice activity detection
★ 74updated 2024-11-22awesomelistsadspeechspeech-activity-detection
Android Voice Activity Detection (VAD) library. Supports WebRTC VAD GMM, Silero VAD DNN, Yamnet VAD DNN models.
★ 487Cupdated 2025-07-15androidaudio-processingdeep-neural-networksdnngmm
Voice activity detector (VAD) for the browser with a simple API
★ 1,945TypeScriptupdated 2026-01-30onnxruntimesilero-vadspeech-to-texttypescriptvoice-activity-detection
Silero VAD: pre-trained enterprise-grade Voice Activity Detector
★ 8,899Pythonupdated 2026-03-26onnxonnx-runtimeonnxruntimepytorchspeech
Local Groq Desktop chat app with MCP support
★ 390JavaScriptupdated 2026-02-14managed-by-terraform
Official, Anthropic-managed directory of high quality Claude Code Plugins.
★ 17,876Pythonupdated 2026-04-20claude-codemcpskills
🤖 PLN Droid Orchestrator - An intelligent AI orchestration system for coordinating specialized droids to accomplish complex development tasks
★ 363updated 2026-03-23
Open source voice dictation technology
★ 880TypeScriptupdated 2026-04-19agentagentic-aidictationfreelocal-ai
★ 1updated 2025-12-27
CLI for running Claude Code with GLM-4.7, MiniMax M2.1, Kimi K2, AWS Bedrock, GCP Vertex, and more.
★ 9TypeScriptupdated 2025-12-26
Twine, a tool for telling interactive, nonlinear stories
★ 2,718TypeScriptupdated 2026-04-19
Parallax is a distributed model serving framework that lets you build your own AI cluster anywhere
★ 1,259Pythonupdated 2026-04-12blackwellchatbotdecentralized-inferencedeepseekdistributed-systems
🤖 Community fork of Google's Gemini CLI for Qwen AI models. A powerful command-line tool that uses Alibaba Cloud's Qwen models to understand your code, automate workflows, and accelerate development. Features multilingual support (EN/CN), model switching, and web search integration.
★ 57TypeScriptupdated 2025-07-05aialibabacloudautomationchinesecli
open-source coding LLM for software engineering tasks
★ 1,201Pythonupdated 2025-09-30
AI writing agent powered by kimi-k2-thinking - autonomously creates novels and stories with deep reasoning
★ 565Pythonupdated 2026-01-29
Kimi Code CLI is your next CLI agent.
★ 8,221Pythonupdated 2026-04-20
ChatDBG - AI-assisted debugging. Uses AI to answer 'why'
★ 1,098Pythonupdated 2026-01-29c-programmingcpp-programmingdebuggerdebugging-toolsgpt-3
Awesome AI Benchmarks
★ 31TypeScriptupdated 2026-01-16
Voice Activity Detector (VAD) : low-latency, high-performance and lightweight
★ 2,091Cupdated 2026-02-02audioautomatic-speech-recognitionconversational-aireal-timesilero-vad
Library for controlling DALI lighting systems
★ 207Pythonupdated 2026-01-09daliiec-62386lightingpython
BACnet Protocol Stack library provides a BACnet application layer, network layer and media access (MAC) layer communications services.
★ 553Cupdated 2026-04-20avrbacnetbacnet-clientbacnet-ipbacnet-library
BACnet protocol library for .NET :satellite:
★ 248C#updated 2026-01-21ashraeautomationbacnetbacnet-librarynuget
Reading list for research topics in state-space models
★ 361updated 2026-04-14mambastate-space-models
VMamba: Visual State Space Models,code is based on mamba
★ 3,133Pythonupdated 2025-03-07
Mamba SSM architecture
★ 18,089Pythonupdated 2026-04-16
The Intelligent GUI Agent for Mobile Phones
★ 1,801Pythonupdated 2026-04-15
A curated list of awesome open source healthcare tools, algorithms, datasets and research papers.
★ 320updated 2025-01-20awesome-listawesome-listshealthcarehealthcare-applicationhealthcare-datasets
Use AI chatbots like Claude or ChatGPT, particularly their projects function, to help track, diagnose, and recovery from chronic illness.
★ 100updated 2025-01-09
Grab top 10 github trending projects every day and save it to issues. You can subscribe by watching this repo or via RSS
★ 28JavaScriptupdated 2026-01-09
Voice-cloned smart attention TTS notifications for Claude Code. AI summarizes deep work session responses, speaks in your cloned voice. MLX Chatterbox Turbo on Apple Silicon. Zero config, works out of the box.
★ 8Pythonupdated 2026-01-15apple-siliconchatterboxclaude-codeclaude-code-pluginmlx
Easy one shot installer for configuring Chatterbox's TTS models (Original and Turbo)
★ 3Pythonupdated 2025-12-17
★ 3JavaScriptupdated 2025-12-15pinokio
SWE-bench: Can Language Models Resolve Real-world Github Issues?
★ 4,782Pythonupdated 2026-04-01benchmarklanguage-modelsoftware-engineering
Vesktop is a custom Discord App aiming to give you better performance and improve linux support
★ 7,866TypeScriptupdated 2026-04-11
The cutest Discord modification
★ 13,154TypeScriptupdated 2026-04-17discordmodpluginsthemesvendetta
Better Discord enhances Discord desktop app with new features.
★ 9,011TypeScriptupdated 2026-04-01betterdiscorddiscord
Legcord is a custom client designed to enhance your Discord experience while keeping everything lightweight.
★ 3,058TypeScriptupdated 2026-04-16armcorddiscorddiscord-clientdiscord-moddiscord-plugin
Gorgeous Claude Code Extend for VS Code.
★ 1,078Vueupdated 2026-04-01
Real-time multi-AI collaboration: Claude, Codex & Gemini with persistent context, minimal token overhead
★ 2,351Pythonupdated 2026-04-18ai-collaborationai-toolsclaude-codeclicodex
🔂 Ralph loop with PRs: Run Claude Code in a continuous loop, autonomously creating PRs, waiting for checks, and merging
★ 1,313Shellupdated 2026-04-03aiai-agentsclaudeclaude-codecontinuous-ai
A world-class collection of Claude Code utilities: autonomous skills, expert agents, slash commands, and prompts that supercharge your development workflow
★ 697Shellupdated 2026-02-25agent-development-kitagentic-aiagentic-codingagentic-workflowagents
Official Compound Engineering plugin for Claude Code, Codex, Cursor, and more
★ 15,546TypeScriptupdated 2026-04-20compoundengineering
🐝 Multi-agent swarm coordination for OpenCode with learning capabilities, agent issue tracking, and management
★ 645TypeScriptupdated 2026-02-23ai-agentsmachine-learningmulti-agentopencodeswarm
Mobile-first web interface for OpenCode AI agents. Manage, control, and code with multiple OpenCode agents from any device - your phone, tablet, or desktop. Features Git integration, file management, and real-time chat in a responsive PWA. Deploy with Docker for instant setup.
★ 523TypeScriptupdated 2026-04-19agentjavascriptmobileweb
Dynamic context pruning plugin for OpenCode - intelligently manages conversation context to optimize token usage
★ 2,334TypeScriptupdated 2026-04-12
Autonomous multi-session AI coding
★ 14,082TypeScriptupdated 2026-03-23
IDE-like frontend for Opencode (non-affiliated community project)
★ 2TypeScriptupdated 2025-12-23
Network diagrams that update themselves
★ 4,803Rustupdated 2026-04-20documentationdocumentation-generatordocumentation-toolshomelabnetwork-analysis
LSP-AI is an open-source language server that serves as a backend for AI-powered functionality, designed to assist and empower software engineers, not replace them.
★ 3,162Rustupdated 2025-01-07aiauto-completiondeveloper-toolsidelanguage-client
Universal skills loader for AI coding agents - npm i -g openskills
★ 9,919TypeScriptupdated 2026-01-18
A curated list of awesome plugins, themes, agents, projects, and resources for https://opencode.ai
★ 5,765JavaScriptupdated 2026-03-21
Mobile App for OpenCode and more
★ 133Dartupdated 2025-11-05aiaicodingcliopencode
JetKVM - Control any computer remotely
★ 4,573TypeScriptupdated 2026-04-09kvm
HAckable Text Input System (HATIS)
★ 14Common Lispupdated 2025-07-06common-lispinput-methodinput-systemsbclwayland
Python library for mouse & keyboard automation on Wayland — click, swipe, type, hotkeys & cursor tracking. Works on Hyprland, Sway, labwc & all wlroots compositors. The PyAutoGUI alternative for Wayland.
★ 32Pythonupdated 2026-04-09archlinuxautomationcursor-trackinghyprlandkeyboard
Simple virtual keyboard for wayland
★ 49C++updated 2025-11-23gtk4gtkmm4oskvirtual-keyboard
Transcribe audio and video files with speaker diarization and logically grouped timestamps using Gemini Flash
★ 61Svelteupdated 2026-04-07geminigemini-flashspeaker-diarizationspeech-to-textsveltekit
TypeScript & JavaScript ORM for Node.js — supports PostgreSQL, MySQL, MariaDB, SQLite, SQL Server, Oracle, and more.
★ 36,464TypeScriptupdated 2026-04-20active-recordcockroachdbdata-mapperdatabasehacktoberfest
TypeScript is a superset of JavaScript that compiles to clean JavaScript output.
★ 108,667TypeScriptupdated 2026-04-20javascriptlanguagetypecheckertypescript
MCP server for printing documents on macOS/Linux via CUPS
★ 6TypeScriptupdated 2026-02-14
Yet another barcode scanner for Android
★ 2,144Kotlinupdated 2026-04-11androidandroid-camerahacktoberfestkotlin-androidrenderscript
Home assistant custom component to start Spotify playback on an idle chromecast device as well as control spotify connect devices
★ 805Pythonupdated 2026-03-12
Make text LLMs listen and speak
★ 1,274Pythonupdated 2026-03-26
Inworld TTS
★ 716Pythonupdated 2026-04-14
A simple cross-platform utility written in Python which can update Brother printer firmwares
★ 138Pythonupdated 2025-12-02
Open Source Inventory Management System
★ 6,877Pythonupdated 2026-04-19djangohacktoberfestpython
Brother QL Printer App is a modern web application designed to simplify the process of printing labels on Brother QL series label printers. It provides a user-friendly interface and comprehensive API for printing text, images, and QR codes on labels with customizable settings.
★ 10Pythonupdated 2025-08-18brotherbrother-label-printerbrother-qlflaskhome-assistant
A full featured Thermostat for Home Assistant: presets, window, motion, presence and overpowering management
★ 1,034Pythonupdated 2026-04-20hacs-customhacs-integrationhome-assistantpythonthermostat
A collection of awesome markdown editors & (pre)viewers for Linux, Apple OS X, Microsoft Windows, the World Wide Web & more
★ 1updated 2025-12-16
Welcome to Optery’s open-source directory of data brokers and opt-out information, the largest of its kind.
★ 49updated 2026-04-01optoutpiiprivacy
Context engineering plugin for Opencode that preserves your edited files and consolidates them to declutter history. WIP.
★ 2TypeScriptupdated 2025-12-19
Specification and documentation for Agent Skills
★ 17,184Pythonupdated 2026-04-14agent-skills
This is a curated list of awesome custom ROMs for Android devices. Each ROM offers unique features and customization options to enhance your Android experience.
★ 158updated 2026-02-17androidaospaosp-androidcustom-romcustom-roms
This is a Streamlit application that allows two local Ollama models to chat with each other.
★ 55Pythonupdated 2025-10-21
A collection of awesome browser extensions for GitHub.
★ 3,249JavaScriptupdated 2024-08-18awesomeawesome-listbrowser-extensionchrome-extensiongithub
Claude Pro Directory is a searchable collection of pre-built configurations, MCP servers, and custom rules designed to enhance Claude AI's performance for specific tasks.
★ 1updated 2025-12-19
(ෆ`꒳´ෆ) A Survey on Text-to-Image Generation/Synthesis.
★ 2,436updated 2026-02-07awseome-listgenerative-adversarial-networkimage-generationimage-manipulationimage-synthesis
MCP for Proxmox integration in Cline
★ 249Pythonupdated 2025-02-19
Agent Skills as a Memory Layer
★ 3,346JavaScriptupdated 2026-04-15agentagent-development-kitagent-observabilityai-agentanthropic
Open source, local, and self-hosted Amazon Echo/Google Home competitive Voice Assistant alternative
★ 3,017Cupdated 2026-02-13alexadeep-learningechoesp-adfesp-idf
A Private and Open Source AI-Powered Voice Assistant & Multisensor for Home Assistant
★ 142updated 2025-04-15hardwarehome-assistantsmart-homevoice-assistant
Home Assistant Voice PE
★ 658C++updated 2026-04-20
The most powerful and modular stable diffusion GUI, api and backend with a graph/nodes interface. Now ZLUDA enhanced for better AMD GPU performance.
★ 869Pythonupdated 2026-04-19amdcomfyuicudarocmstable-diffusion
AMD GPU Monitor for ComfyUI
★ 11JavaScriptupdated 2025-03-13
Portable ComfyUI installer for Windows, macOS and Linux 🔹 Nvidia GPU support 🔹 Pixaroma Community Edition
★ 1,147Batchfileupdated 2026-04-19comfyuicomfyui-easy-installcomfyui-installercomfyui-portable-installerpixaroma
Monica – Cross-platform open-source image editor with AI features, RAW support, and a modern customizable UI.
★ 187Kotlinupdated 2026-04-17cross-platformdeeplearningimage-processingimageeditorjni
Full Stack AI Image Editor with Next JS, Fabric.js, Tailwind, ImageKit, Shadcn UI Tutorial
★ 50JavaScriptupdated 2025-07-21
:blue_book: Home Assistant User documentation
★ 9,145HTMLupdated 2026-04-20documentationhacktoberfesthasshassiohome-assistant
Think DSP: Digital Signal Processing in Python, by Allen B. Downey.
★ 4,522Jupyter Notebookupdated 2026-02-13
A bot library for Lemmy, the fediverse link aggregator.
★ 103TypeScriptupdated 2026-04-02botbotsfediversefediverse-botlemmy
OpenMMLab's Next Generation Video Understanding Toolbox and Benchmark
★ 5,002Pythonupdated 2026-03-18action-recognitionavabenchmarkdeep-learningi3d
A deep learning library for video understanding research.
★ 3,554Pythonupdated 2026-01-12
🔥🔥🔥 [IEEE TCSVT] Latest Papers, Codes and Datasets on Vid-LLMs.
★ 3,162updated 2026-03-28
Given an URL to an AppImage, the GitHub action in this project inspects the AppImage and puts it into a community-maintained catalog
★ 354Shellupdated 2026-04-07appimagecatalog
💾 Model Context Protocol (MCP) server for Synology NAS - Enables AI assistants (Claude, Cursor, Continue) to manage files, downloads, and system operations through secure API integration. Features Docker deployment, auto-authentication, and comprehensive file system tools.
★ 92Pythonupdated 2026-04-01mcpmcp-serversynology
A Model Context Protocol (MCP) server that enables Claude Desktop to check domain availability across 50+ TLDs. Features DNS/WHOIS verification, bulk checking, and smart suggestions. Zero-clone installation via uvx.
★ 45Pythonupdated 2025-10-30ai-toolsanthropicclaudeclaude-aiclaude-desktop
A Model Context Protocol for checking domain name registration status in bulk.
★ 36Goupdated 2025-10-24golangmcp-server
Limiter, compressor, convolver, equalizer and auto volume and many other plugins for PipeWire applications
★ 9,357HTMLupdated 2026-04-20auto-volumecompressorequalizerkdekirigami2
Janus-Series: Unified Multimodal Understanding and Generation Models
★ 17,700Pythonupdated 2025-02-01any-to-anyfoundation-modelsllmmultimodalunified-model
GLM-ASR-Nano: A robust, open-source speech recognition model with 1.5B parameters
★ 797Pythonupdated 2026-03-06asredgellmvoice
★ 66Pythonupdated 2026-04-20
MCP server for Fal.ai - Generate images, videos, music and audio with Claude
★ 43Pythonupdated 2026-03-30ai-toolsclaudefal-aiimage-generationllm
MCP Server MetaMCP manages all your other MCPs in one MCP.
★ 154TypeScriptupdated 2025-06-25
Model Manager is a Python package that simplifies the process of deploying an open source AI model to your own cloud.
★ 339Pythonupdated 2024-05-20
AI Image Toolkit that runs fully in your browser — free, private, and offline-first.
★ 640TypeScriptupdated 2026-04-18background-removalbackgroundremoverimageprocessingonnxruntimeonnxruntime-web
Virtual webcam that takes real webcam footage and replaces the background in order to have Virtual Backgrounds in MS Teams for Linux where the feature is unimplemented.
★ 84Pythonupdated 2023-05-16background-removallinuxpythonv4l2loopbackvideo
Bria RMBG 2.0 - image background removee
★ 215Pythonupdated 2025-12-11aibackground-removalbirefnetbriaaigenerative-ai
Sammie-Roto is a tool for AI assisted masking / background removal
★ 138Pythonupdated 2025-11-23
RemBG Desktop Applicattion - useful for batch processing and cross-platform GUI
★ 18updated 2025-09-13batch-background-removalrembg-desktoprembg-guiremoveremove-background
🔥 Open Source Browser API for AI Agents & Apps. Steel Browser is a batteries-included browser sandbox that lets you automate the web without worrying about infrastructure.
★ 6,918TypeScriptupdated 2026-04-16aiai-agentsai-toolsbrowser-automationllm
VDU controls - a control panel for monitor brightness/contrast/...
★ 226Pythonupdated 2026-04-20bh1750ddcddcutilguigy-30
Graphical user interface for ddcutil - control monitor settings
★ 237C++updated 2026-02-06
Display brightness slider for gnome shell using ddcutil backend
★ 419JavaScriptupdated 2026-04-14
Server-enforced workflow discipline for AI agents. An MCP server providing persistent work items, dependency graphs, quality gates, and actor attribution. Schemas define what agents must produce — the server blocks the call if they don't. Works with any MCP-compatible client.
★ 182Kotlinupdated 2026-04-16ai-coding-assistantai-developmentai-harnessai-memoryai-tools
RepoMaster: The open-source AI agent that masters GitHub. It turns any code repository into a powerful tool, achieving a new level of autonomous task-solving. An open alternative to Claude-Code.
★ 520Pythonupdated 2025-11-05claude-codecode-agentgittaskbenchmle-benchopenhands
CCNotify provides desktop notifications for Claude Code, alerting you when Claude needs your input or completes tasks.
★ 176Pythonupdated 2025-10-14
VS Code/Cursor extension for automating Claude Code tasks with intelligent queuing, batch processing, and auto-resume.
★ 228TypeScriptupdated 2025-08-21claudeclaude-codecursorcursor-aicursor-extension
An Open Phone Agent Model & Framework. Unlocking the AI Phone for Everyone
★ 25,072Pythonupdated 2026-03-06agentphone-use-agent
Remote control for your Lyrion Music Server and players.
★ 111Javaupdated 2026-04-15androidopen-sourcesqueezebox
Telegram Bot MCP
★ 35Pythonupdated 2025-05-23
Telegram Bot API server
★ 4,181C++updated 2026-04-03
🤖 A Telegram bot that integrates with OpenAI's official ChatGPT APIs to provide answers, written in Python
★ 3,451Pythonupdated 2025-06-03chatgptdall-eopenaipythontelegram-bot
Python Telegram bot api.
★ 8,726Pythonupdated 2026-04-19bot-apipython-apitelegramtelegram-bottelegram-bot-api
Java library to create bots using Telegram Bots API
★ 5,442Javaupdated 2026-03-15javajava-libraryjitpackmavenpolling
Open Source Multiroom Audio Streamer based on Raspberry Pi & Snapcast
★ 460Shellupdated 2026-04-19airplayaudiocamilladspdebianlibrespot
Snapcast Multiroom audio docker image
★ 43Dockerfileupdated 2026-03-28dockerdocker-imagelinuxservermopidymultiroom
Next Generation Agentic Proxy for AI Agents and MCP servers
★ 2,498Rustupdated 2026-04-17agentsaiai-gatewayapi-gatewaygateway-api
An MCP proxy server that aggregates and serves multiple MCP resource servers through a single HTTP server.
★ 681Goupdated 2026-02-19claudemcpmcp-clientmcp-servermodelcontextprotocol
A bridge between Streamable HTTP and stdio MCP transports
★ 2,460Pythonupdated 2026-04-13mcpmcp-serverproxyssestreamable-http
api router for MCP Servers
★ 305Goupdated 2025-07-22chatmcpmcpmcproutermcpservers
Labs to explore AI Models, MCP servers, and Agents with the AI Gateway powered by Azure API Management and Microsoft Foundry 🚀
★ 905Jupyter Notebookupdated 2026-04-17a2aagentsapimanagementautogenazure
Telegram MCP server powered by Telethon to let MCP clients read chats, manage groups, and send/modify messages, media, contacts, and settings.
★ 1,004Pythonupdated 2026-04-12adminapichat-managementcontactsgroups
A list of tools, papers and code related to Deepfake Detection.
★ 1,763updated 2025-09-02awesomecodedatasetdeepfake-detectiondeepfakes
A comprehensive benchmark of deepfake detection
★ 1,032Pythonupdated 2025-08-20
An Open Source DeepFake Detection Platform
★ 108Pythonupdated 2026-03-28
A simple to use python library for creating podcasts with support for many LLM and TTS providers
★ 113Pythonupdated 2026-03-03
A curated list of useful Generative AI APIs for developers
★ 214Dartupdated 2026-03-19apigenaigenerative-aigssochacktoberfest
[NVIDIA, MAC, ROCM] Emotionally Expressive and Duration-Controlled Auto-Regressive Zero-Shot Text-to-Speech application (Minimum Requirements 8GB VRAM / 32 GB RAM, Recommended Requirements 16GB VRAM 24GB RAM)
★ 6JavaScriptupdated 2025-12-22pinokiotts
concurrent, cache-efficient, and Dockerfile-agnostic builder toolkit
★ 9,927Goupdated 2026-04-18builderbuildkitcloud-nativecontainersdocker
Docker CLI plugin for extended build capabilities with BuildKit
★ 4,370Goupdated 2026-04-17
A generative speech model for daily dialogue.
★ 39,153Pythonupdated 2026-04-10agentchatchatgptchatttschinese
Data manipulation and transformation for audio signal processing, powered by PyTorch
★ 2,869Pythonupdated 2026-04-20audioaudio-processingiomachine-learningpython
A GPU cluster manager that configures and orchestrates inference engines like vLLM and SGLang for high-performance AI model deployment.
★ 4,903Pythonupdated 2026-04-20ascendcudadeepseekdistributed-inferencegenai
AI Tensor Engine for ROCm
★ 414Pythonupdated 2026-04-20
(NVIDIA) FramePack is a next-frame (next-frame-section) prediction neural network structure that generates videos progressively.
★ 21Pythonupdated 2025-12-18pinokio
OBS plugin for local speech recognition and captioning using AI
★ 1,458C++updated 2026-04-09ailive-streaminglivestreamobsobs-studio
TypeScript-centric app development platform: notebook and AI app builder
★ 3,450TypeScriptupdated 2026-04-06aijavascriptlocalnotebooktypescript
MCP Dockmaster allows you to easily install and manage MCP servers. Available for Mac, Windows and Linux as a Desktop App, CLI and a library.
★ 84Rustupdated 2025-06-05aicryptomcptools
Explore, Install, Innovate — in 1 Click.
★ 171TypeScriptupdated 2026-04-01aiai-explorerappdioneelectron
1 min voice data can also be used to train a good TTS model! (few shot voice cloning)
★ 56,969Pythonupdated 2026-04-19text-to-speechttsvitsvoice-clonevoice-cloneai
Official SoundCloud Javascript SDK
★ 392JavaScriptupdated 2026-04-19
Mopidy extension for playing music from SoundCloud
★ 188Pythonupdated 2026-03-04mopidymopidy-backendpythonsoundcloud
Soundcloud Music Downloader
★ 3,980Pythonupdated 2026-04-14downloadermusicpythonsoundcloudsoundcloud-music-downloader
🍊 :bar_chart: :bulb: Orange: Interactive data analysis
★ 5,605Pythonupdated 2026-04-17classificationclusteringdata-miningdata-sciencedata-visualization
🤳🥫 The new Open Food Facts mobile application for Android and iOS, crafted with Flutter and Dart
★ 1,301Dartupdated 2026-04-19androiddartdartlangflutterflutter-app
Enhanced background remove and replace app built around BRIA-RMBG-2.0. Low VRAM/RAM | 6GB Install
★ 247Pythonupdated 2026-03-30
Dead simple FLUX LoRA training UI with LOW VRAM support
★ 3,206Pythonupdated 2026-03-31
A curated list of recent diffusion models for video generation, editing, and various other applications.
★ 5,610updated 2026-04-03awesomediffusion-modelsmotion-customizationvideo-editingvideo-generation
Swap GPT for any LLM by changing a single line of code. Xinference lets you run open-source, speech, and multimodal models on cloud, on-prem, or your laptop — all through one unified, production-ready inference API.
★ 9,261Pythonupdated 2026-04-20artificial-intelligencechatglmdeploymentflan-t5gemma
🚀 One-stop solution for creating your AI twin from chat history 💡 Fine-tune LLMs with your chat logs to capture your unique style, then bind to a chatbot to bring your digital self to life. 从聊天记录创造数字分身的一站式解决方案
★ 17,652Pythonupdated 2026-04-14chat-historydigital-avatarllmqwentelegram
Awesome generative art
★ 1,812updated 2024-06-04artistsawesomeawesome-listgenerative-artopenframeworks
A powerful tool that translates ComfyUI workflows into executable Python code.
★ 2,310Pythonupdated 2026-04-19ai-artcomfyuigenerative-artimage-generationpytorch
Creative Coding: Generative Art, Data visualization, Interaction Design, Resources.
★ 14,731HTMLupdated 2026-04-013d-graphicsartawesomeawesome-listcomputer-graphics
SD.Next: All-in-one WebUI for AI generative image and video creation, captioning and processing
★ 7,075Pythonupdated 2026-04-20ai-artcaptiondiffusersgenerative-artpython
🤗 Diffusers: State-of-the-art diffusion models for image, video, and audio generation in PyTorch.
★ 33,452Pythonupdated 2026-04-18deep-learningdiffusionfluximage-generationimage2image
PALLAIDIUM — a generative AI movie studio, seamlessly integrated into the Blender Video Editor (VSE), enabling end-to-end production from script to screen and back.
★ 1,368Pythonupdated 2026-04-03aiaicinemablenderchatterboxdiffusion
Build apps that AI can generate, humans can review, and teams can maintain. Config that works between code and natural language.
★ 2,956JavaScriptupdated 2026-04-20admin-panelscrud-appsdashboardsinternal-toolinternal-tools
Conductor is a microservices orchestration engine.
★ 12,772Javaupdated 2023-12-22distributed-systemsgrpcjavajavascriptmicroservice-orchestration
An orchestration platform for the development, production, and observation of data assets.
★ 15,389Pythonupdated 2026-04-18analyticsdagsterdata-engineeringdata-integrationdata-orchestrator
Conductor is an event driven agentic orchestration platform providing durable and highly resilient execution engine for applications and AI Agents
★ 31,701Javaupdated 2026-04-20distributed-systemsdurable-executiongrpcjavajavascript
A visual node-based editor for building, sharing, and executing complex AI workflows with Fal.ai and Replicate.
★ 96TypeScriptupdated 2025-11-23aicomfyui-webfal-aigenerative-ailow-code
Replicate Flux LoRA image editor.
★ 54Vueupdated 2024-09-03
Fresh builds of llama.cpp with AMD ROCm™ 7 acceleration
★ 388Pythonupdated 2026-04-19
The AMD rocAL is designed to efficiently decode and process images and videos from a variety of storage formats and modify them through a processing graph programmable by the user.
★ 23C++updated 2026-04-14
Focus on prompting and generating
★ 1Pythonupdated 2023-10-06
SwarmUI (formerly StableSwarmUI), A Modular Stable Diffusion Web-User-Interface, with an emphasis on making powertools easily accessible, high performance, and extensibility.
★ 4,009C#updated 2026-04-18aicomfyuicsharpimage-generationjavascript
Focus on prompting and generating
★ 48,182Pythonupdated 2025-12-01
A Claude Code plugin that automatically captures everything Claude does during your coding sessions, compresses it with AI (using Claude's agent-sdk), and injects relevant context back into future sessions.
★ 67,599TypeScriptupdated 2026-04-20aiai-agentsai-memoryanthropicartificial-intelligence
AI Audio Datasets (AI-ADS) 🎵, including Speech, Music, and Sound Effects, which can provide training data for Generative AI, AIGC, AI model training, intelligent audio tool development, and audio applications.
★ 930updated 2025-07-08aigcartificial-intelligenceaudioaudio-effectaudio-generation
Evaluate your speech-to-text system with similarity measures such as word error rate (WER)
★ 881Pythonupdated 2026-04-16automatic-speech-recognitionevaluation-metricspython3speech-to-textwer
★ 164Pythonupdated 2025-11-20
Give your agents the power of the Hugging Face ecosystem
★ 10,317Pythonupdated 2026-04-16
General purpose 3D and 2D game engine using Go (golang) and Vulkan with built in editor
★ 4,464Goupdated 2026-04-20game-enginegame-engine-2dgame-engine-3dgame-engine-developmentgame-engine-framework
Free in-browser audio & video censorship tool. AI-powered transcription with Whisper, 100% private client-side processing. Bleep profanity, custom words, or any phrase.
★ 63TypeScriptupdated 2026-04-16ffmpegpodcastprofanity-filterspeech-to-texttransformersjs
Rudimentary program for speech transcription, manipulation, and redaction.
★ 5Pythonupdated 2024-07-17audiocensorcensorshippydubredaction
Graph-aware TUI for the Beads issue tracker: PageRank, critical path, kanban, dependency DAG visualization, and robot-mode JSON API
★ 1,475Goupdated 2026-04-04developer-toolsgograph-analysisissue-trackertui
[ACL 2025] Benchmarking Open-ended Audio Dialogue Understanding for Large Audio-Language Models
★ 7Pythonupdated 2025-05-29
Elucidated Text-To-Audio (ETTA) is a SOTA text-to-audio model with a holistic understanding of the design space and trained with synthetic captions.
★ 114Pythonupdated 2026-03-03
OmniVinci is an omni-modal LLM for joint understanding of vision, audio, and language.
★ 658Pythonupdated 2026-02-26audio-language-modeldeep-learninglarge-language-modelsmultimodal-large-language-modelsvision-language-model
Ming-UniAudio: Speech LLM for Joint Understanding, Generation and Editing with Unified Representation
★ 443Pythonupdated 2025-11-27speechspeech-recognitionspeech-synthesisunified-model
PyTorch implementation of Audio Flamingo: Series of Advanced Audio Understanding Language Models
★ 1,103updated 2025-12-15audio-captioningaudio-language-modelsaudio-question-answeringaudio-reasoningmultimodal-large-language-models
Step-Audio 2 is an end-to-end multi-modal large language model designed for industry-strength audio understanding and speech conversation.
★ 1,399Pythonupdated 2026-03-16
Learn how multimodal AI merges text, image, and audio for smarter models
★ 30Jupyter Notebookupdated 2025-01-21dalle-3deepgramdiffusiondreamboothgenerative-ai
Qwen2.5-Omni is an end-to-end multimodal model by Qwen team at Alibaba Cloud, capable of understanding text, audio, vision, video, and performing real-time speech generation.
★ 3,981Jupyter Notebookupdated 2025-06-12
ElevenLabs UI is a component library and custom registry built on top of shadcn/ui to help you build multimodal agents faster.
★ 2,184TypeScriptupdated 2026-04-15agentsaiaudiocomponentselevenlabs
High-performance data engine for AI and multimodal workloads. Process images, audio, video, and structured data at any scale
★ 5,437Rustupdated 2026-04-20ai-engineeringai-pipelinearrowartificial-intelligencebig-data
Macaw-LLM: Multi-Modal Language Modeling with Image, Video, Audio, and Text Integration
★ 1,591Pythonupdated 2025-01-01deep-learninglanguage-modelmachine-learningmulti-modal-learningnatural-language-processing
SALMONN family: A suite of advanced multi-modal LLMs
★ 1,412updated 2026-04-20audioaudio-processingaudio-visual-understandingbytedanceiclr2024
Your faithful, impartial partner for audio evaluation — know yourself, know your rivals. 真实评测,知己知彼。
★ 290Pythonupdated 2026-04-08evaluationspeech-recognitionspeech-to-speechspeech-to-text
OpenAI-compatible TTS API that unifies multiple backends with smart chunking for unlimited-length generation
★ 49Pythonupdated 2025-12-08
★ 19JavaScriptupdated 2025-12-05
Qwen3-omni is a natively end-to-end, omni-modal LLM developed by the Qwen team at Alibaba Cloud, capable of understanding text, audio, images, and video, as well as generating speech in real time.
★ 3,705Jupyter Notebookupdated 2026-01-08
AudioBench: A Universal Benchmark for Audio Large Language Models
★ 303Pythonupdated 2025-06-17audio-scene-understandingspeechspeech-question-answeringspeech-recognition
★ 57Pythonupdated 2026-04-17
Audio Large Language Models
★ 912Pythonupdated 2025-07-05audio-languageaudio-processingaudio-understanding
Kimi-Audio, an open-source audio foundation model excelling in audio understanding, generation, and conversation
★ 4,590Pythonupdated 2025-06-21
🔥🔥🔥 A curated list of papers on LLMs-based multimodal generation (image, video, 3D and audio).
★ 548HTMLupdated 2025-04-04aigclarge-language-modelslarge-vision-language-modelsllmlvlm
One-for-All Multimodal Evaluation Toolkit Across Text, Image, Video, and Audio Tasks
★ 4,063Pythonupdated 2026-04-20agiaudio-evaluationbenchmarkevaluationlarge-language-models
Free and open source self-hosting serverless podcast solution
★ 175Astroupdated 2024-04-06astropodcastpodcastingself-hostedserverless
Serverless implementation of Text-To-Speech
★ 6Pythonupdated 2025-02-21
Easy to use stem (e.g. instrumental/vocals) separation from CLI or as a python package, using a variety of amazing pre-trained models (primarily from UVR)
★ 1,154Pythonupdated 2026-04-20
A GUI for music separation AI demucs
★ 1,093Pythonupdated 2025-06-20
Ultimate Vocal Remover CLI
★ 165Pythonupdated 2025-02-05uvrvocalremover
GUI for a Vocal Remover that uses Deep Neural Networks.
★ 24,423Pythonupdated 2025-03-13audioinstrumentalkaraokekareokeemusic
Command Line Interface for Managing ComfyUI
★ 760Pythonupdated 2026-04-20aicomfyuicommand-linestable-diffusion
An open source AI wearable device that captures what you say and hear in the real world and then transcribes and stores it on your own server. You can then chat with Adeus using the app, and it will have all the right context about what you want to talk about - a truly personalized, personal AI.
★ 3,401TypeScriptupdated 2024-04-22aiopenopen-source-aiwearwearable
Optimized Whisper models for streaming and on-device use
★ 829Pythonupdated 2026-04-09apple-siliconcoremlmlxnvidia-gpuon-device-ai
Remove Backgrounds With AI & GIMP
★ 29Pythonupdated 2024-09-14
A free and open-source AI plugin for automatic background removal in DaVinci Resolve Fusion.
★ 148Pythonupdated 2026-02-07background-removaldavincidavinci-resolvedavincistudiofusion
git worktree + containerization + agent harness
★ 35TypeScriptupdated 2026-04-20
🔊 A comprehensive list of open-source datasets for voice and sound computing (95+ datasets).
★ 2,159updated 2024-06-06audio-datasetaudio-datasetsdatadatasetdatasets
A Basic Call Recorder for rooted Android devices
★ 2,713Kotlinupdated 2026-04-03
A curated list of open-source projects built by the CrewAI community. Discover, contribute, and extend the possibilities of AI agents with CrewAI.
★ 487updated 2025-06-09
large population models
★ 606Jupyter Notebookupdated 2026-04-02agent-based-modelingai-agents-frameworkautograddifferentiable-simulationsscientific-computing
Go library for the WhatsApp web multidevice API
★ 5,957Goupdated 2026-04-16gogolangwhatsappwhatsapp-web
This app can now use Android, just like a human.
★ 904Kotlinupdated 2026-01-13accessibilityagentai-assistantai-automationapp
Bloatware remover tools for all android ROM out there...
★ 39Shellupdated 2025-11-29androidandroid-bloatwarebloatwarebloatware-removalmiui
Android ADB desktop app
★ 4,987TypeScriptupdated 2025-12-25adbandroidelectronelectron-app
ADB in your browser
★ 3,026TypeScriptupdated 2026-04-18adbandroidandroid-debug-bridgeandroid-phonescrcpy
Radeon GPU Profiler (RGP) is a tool from AMD that allows for deep inspection of GPU workloads.
★ 443updated 2025-12-11
🚀 Unleash AMD GPU Performance: Fix PyTorch ROCm detection for 4x AI/ML speedup on RX 6000/7000 series for Pinokio and developers / custom setups
★ 17Pythonupdated 2025-08-24
AMD Ryzen™ AI Software includes the tools and runtime libraries for optimizing and deploying AI inference on AMD Ryzen™ AI powered PCs.
★ 803Pythonupdated 2026-04-17
AI Inferencing at the Edge. A simple one-file way to run various GGML models with KoboldAI's UI with AMD ROCm offloading
★ 766C++updated 2025-12-30
Installation script for an AI applications using ROCm on Linux.
★ 45Shellupdated 2026-04-183daiamdamdgpuaudio
The world's first open-source multimodal creative assistant This is a substitute for Canva and Manus that prioritizes privacy and is usable locally.
★ 6,170TypeScriptupdated 2026-03-02agentaiaiagentaiimageaiimagegenerator
Music Assistant is a free, opensource Media library manager that connects to your streaming services and a wide range of connected speakers. The server is the beating heart, the core of Music Assistant and must run on an always-on device like a Raspberry Pi, a NAS or an Intel NUC or alike.
★ 1,520Pythonupdated 2026-04-20
A command-line tool for managing MCP servers in Claude App. Also can run a MCP Server to help you manage all your MCP Servers
★ 108TypeScriptupdated 2025-01-06claudeclimcpmodel-context-protocol
Hardware-accelerated video decoding, encoding and processing on Intel graphics through VA-API. This module has been merged into the main GStreamer repo for further development.
★ 117Cupdated 2020-04-10
Docker build for FFmpeg on Ubuntu / Alpine / Centos / Scratch / nvidia / vaapi
★ 1,627Pythonupdated 2026-04-12alpinecentosdockerffmpegnvidia
Free and open source video editor, based on MLT Framework and KDE Frameworks
★ 4,948C++updated 2026-04-20
MLT Multimedia Framework
★ 1,765Cupdated 2026-04-20audioaudio-processingcc-plus-plusffmpeg
Effort free video editing!
★ 4,206Nimupdated 2026-04-17audioaudio-editingaudio-processingautomaticnim
★ 840Pythonupdated 2025-08-06
Open Audio Watermarking Tool
★ 491Pythonupdated 2025-12-22
A coding agent and general agent harness for building and orchestrating agentic applications.
★ 612TypeScriptupdated 2026-04-20aiai-agentai-agentsai-toolscontributions-welcome
A single Gradio + React WebUI with extensions for ACE-Step, OmniVoice, Kimi Audio, Piper TTS, GPT-SoVITS, CosyVoice, XTTSv2, DIA, Kokoro, OpenVoice, ParlerTTS, Stable Audio, MMS, StyleTTS2, MAGNet, AudioGen, MusicGen, Tortoise, RVC, Vocos, Demucs, SeamlessM4T, and Bark!
★ 3,094TypeScriptupdated 2026-04-19ace-stepaiaudio-generationcosyvoicegenerative-ai
The most advanced Nano Banana image generator and editor application. Your central hub for AI image generation and revisions. Intuitive UI features reference images, editing with image masks, version history, and more. Powered by Gemini 2.5 Flash images API.
★ 675TypeScriptupdated 2025-09-17aiimagesboltimageeditingimageeditorimagegeneration
A collection of scripts to flash Tuya IoT devices to alternative firmwares
★ 5,041Pythonupdated 2024-09-0635c3esp8266iotmqttsmarthome
Alternative firmware for ESP8266 and ESP32 based devices with easy configuration using webUI, OTA updates, automation using timers or rules, expandability and entirely local control over MQTT, HTTP, Serial or KNX. Full documentation at
★ 24,295Cupdated 2026-04-19arduinoautomationesp32esp8266firmware
Node to enable seamless multiuser workflow collaboration
★ 96JavaScriptupdated 2025-03-01collaborationcomfyuicomfyui-nodescomfyui-workflowmultiplayer
🦾 EvalGIM (pronounced as "EvalGym") is an evaluation library for generative image models. It enables easy-to-use, reproducible automatic evaluations of text-to-image models and supports customization with user-defined metrics, datasets, and visualizations.
★ 92Pythonupdated 2026-02-05
Mumble is an open-source, low-latency, high quality voice chat software.
★ 7,954C++updated 2026-04-19audioclientcmakecross-platformgaming
MCP SSH Server: 37 tools for remote SSH management | Claude Code & OpenAI Codex | DevOps automation, backups, database operations, health monitoring
★ 168JavaScriptupdated 2026-04-09anthropicautomationbackupclaude-codedatabase
WIP: A MCP server to search, install, uninstall all your MCP servers or services for your Claude App (or more)
★ 17TypeScriptupdated 2025-01-06
GitHub Repos Manager MCP Server that enables your MCP client (e.g., Claude Desktop, Roo Code, etc.) to interact with GitHub repositories using your GitHub personal access token.
★ 20JavaScriptupdated 2025-09-25
🐕 Universal MCP Server Manager - Configure once, manage multiple MCP servers through a single interface. Perfect for Claude Desktop, Claude Code, Cursor, Gemini CLI & AI assistants. Web dashboard, auto-detection, unified proxy layer.
★ 18TypeScriptupdated 2025-10-19ai-assistantclaudecursormcpmodel-context-protocol
A comprehensive tool to manage Model Context Protocol (MCP) configurations for Claude code
★ 24Shellupdated 2025-06-14claude-aiclaude-codeclaude-mcpdevtoolsmcp
CLI tool to manage MCP servers in Claude Code
★ 9Pythonupdated 2025-09-11claude-aiclaude-codeclaude-desktopguigui-application
lightweight Python-based MCP (Model Context Protocol) server for local ComfyUI
★ 291Pythonupdated 2026-02-17comfyuicomfyui-apiimage-mcplocal-datalocal-mcp
An open source `vercel` like deployment platform for Comfy UI
★ 1,504TypeScriptupdated 2025-11-13
Home Assistant companion app for Linux
★ 200Valaupdated 2026-02-24adwaitaflathubflatpakgnomegtk
Linux (KDE?) integration for Home Assistant via MQTT
★ 325C++updated 2026-03-06
Voice satellite for Home Assistant using the ESPHome protocol
★ 399Pythonupdated 2026-04-20
Official code for "F5-TTS: A Fairytaler that Fakes Fluent and Faithful Speech with Flow Matching"
★ 14,380Pythonupdated 2026-04-20
Dockerized FastAPI wrapper for Kokoro-82M text-to-speech model w/CPU ONNX and NVIDIA GPU PyTorch support, handling, and auto-stitching
★ 4,764Pythonupdated 2026-01-04fastapihuggingface-spaceskokorokokoro-ttsonnx
FastMCP Server for Sefaria
★ 16Pythonupdated 2026-02-19
★ 1,351Pythonupdated 2026-01-29
Whisper Flutter Example Speech To Text Offline Android Linux Without Api Key Without FFMPEG
★ 10C++updated 2025-08-02aiazkadevdartflutterggml
Android Input Method Editor (IME) based on RTranslators Whisper implementation
★ 297Javaupdated 2026-04-04
Android Input Method Editor (IME) based on Whisper
★ 565Javaupdated 2026-02-07androidon-device-aiprivacy-protectionspeech-recognitiontranscription
The best Android keyboard for offline speech recognition, using OpenAI's whisper model through whisper.cpp for fast and accurate output.
★ 19Kotlinupdated 2025-02-22
workbench for learning and practicing on-device AI technology in real scenario with online-TV on Android phone, powered by ggml(llama.cpp,whisper.cpp...) and FFmpeg and opencv-mobile
★ 192C++updated 2025-06-12ggml-hexagonllamacpp-android-portonline-tvqualcomm-npustablediffusioncpp-android-port
A flutter library for offline speech-to-text conversion which use whisper.cpp models implementation for Android、iOS、macOS.
★ 51C++updated 2026-04-15androidflutterioswhisperwhisper-cpp
A 100% private AI voice transcription app that converts speech to text in 50+ languages. Built with Compose Multiplatform for Android using Whisper AI - no cloud uploads, all processing happens on-device for complete privacy.
★ 2C++updated 2025-08-05
A 100% private AI voice transcription app that converts speech to text in 100+ languages. Built with Compose Multiplatform for Android & iOS using Whisper AI - no cloud uploads, all processing happens on-device for complete privacy.
★ 684C++updated 2026-04-07androidaudio-playercompose-ioscompose-multiplatformcompose-multiplatform-sample
On-device AI for Android — LLM chat (GGUF/llama.cpp), vision models (VLM), image generation (Stable Diffusion), tool calling, AI personas, RAG knowledge packs, TTS/STT. Fully offline, zero subscriptions, open-source.
★ 379Kotlinupdated 2026-03-15ai-personasandroidgguf-modelsjetpack-composekotlin
Android compatible real-time voice changer and Altered Auditory Feedback (DAF + FAF) app
★ 245C++updated 2026-01-10stftpitchshift
A package manager to manage all your mcp servers across platforms
★ 38JavaScriptupdated 2025-04-30cligithubmcpmodel-context-protocolnode
Claude Desktop Extension for Things, the award-winning personal task manager
★ 46JavaScriptupdated 2025-11-05
Universal MCP Server Configuration Manager
★ 62TypeScriptupdated 2026-01-22claudeclicursorgeminimcp
A centralized manager for Model Context Protocol (MCP) servers with dynamic server management and monitoring
★ 477JavaScriptupdated 2025-10-24aichatgptclaude-aillmslocal-development
Shrimp Task Manager is a task tool built for AI Agents, emphasizing chain-of-thought, reflection, and style consistency. It converts natural language into structured dev tasks with dependency tracking and iterative refinement, enabling agent-like developer behavior in reasoning AI systems.
★ 2,088JavaScriptupdated 2025-08-21agentaicodeagentcoding-assistantcursor-ai
MCP proxy server with lazy loading support - reduces context usage through on-demand tool activation
★ 84Goupdated 2026-01-09mcpmcp-server
Dynamically expose tools from proxied servers based on an Agent Persona
★ 152TypeScriptupdated 2025-10-21agentsclaude-codehypertoolhypertool-mcpllms
This server acts as a central hub for Model Context Protocol (MCP) resource servers.
★ 192TypeScriptupdated 2025-07-27httpmcp-managementmcp-managermcp-proxymcp-proxy-server
A centralized reverse-proxy platform for MCP servers — manage, group, and export as Skills from a single endpoint.
★ 386Goupdated 2026-03-18ai-agentmcpmcp-convert-to-skillmcp-managermcp-proxy
An MCP proxy server that aggregates and serves multiple MCP resource servers through a single interface
★ 199TypeScriptupdated 2025-02-02
A TypeScript streamable HTTP and SSE proxy for MCP servers that use stdio transport.
★ 251TypeScriptupdated 2026-04-13
Custom Visual Studio Code Icons
★ 1,788JavaScriptupdated 2023-09-25designicon-packiconsmicrosoftvisual-studio-code
A comprehensive MCP server for calculating Jewish prayer times (zmanim).
★ 1Pythonupdated 2025-10-31judaism
Open source eval for Torah questions
★ 5Pythonupdated 2026-04-19aipythontorah
New website and API for TorahCalc - Tools for Torah study
★ 26JavaScriptupdated 2026-04-19gematriahacktoberfesthalachahebrew-calendarjudaism
A modern app that brings the jewish library to every device
★ 205Dartupdated 2025-11-26e-booksflutterjudaismtorah
all of the workflows of n8n i could find (also from the site itself)
★ 53,981Pythonupdated 2026-02-11
★ 51Shellupdated 2026-03-08openvoiceosraspberry-pitool
Open Voice OS and/or HiveMind installer using Ansible with an intuitive and easy Text-based User Interface
★ 276Shellupdated 2026-04-13openvoiceos
Remote Coding Agent for the Dynamous Agentic Coding Course and special Black Friday livestream. Connect Claude Code or Codex to Slack, Telegram, GitHub, etc.
★ 348TypeScriptupdated 2025-11-29
Detect and remove emojis from your code. Keep your codebase clean and professional.
★ 2JavaScriptupdated 2025-09-07
Virtual KVM switch for Linux machines
★ 529Rustupdated 2024-07-21keyboardkvmlinuxlinux-desktopmouse
A list of free LLM inference resources accessible via API.
★ 19,373Pythonupdated 2026-04-19aiclaudegeminillamallm
📋 A list of open LLMs available for commercial use.
★ 12,739updated 2025-02-13commerciallarge-language-modelsllmllms
Instant, easy, and predictable development environments
★ 11,487Goupdated 2026-04-16build-systembuild-toolbuildpackcontainersdev-environment
Download web video and audio
★ 5,616C#updated 2026-04-20csharpdownloaderflathubgnomegtk4
Downloads videos and playlists from YouTube
★ 14,803C#updated 2026-04-19downloaddownloaderffmpegmp3mp4
Abstraction layer over YouTube's internal API
★ 3,635C#updated 2026-04-20dotnetdotnet-coredotnet-standarddownloaddownloader
🚀 An awesome list of curated Nano Banana pro prompts and examples. Your go-to resource for mastering prompt engineering and exploring the creative potential of the Nano banana pro(Nano banana 2) AI image model.
★ 9,828updated 2026-04-16gemininanobananananobanana-pronanobanana2nanobananapro
Discover, explore and manage your music library across multiple sources with this beautiful web-based interface. Iris is a Mopidy frontend extension.
★ 1,222JavaScriptupdated 2026-04-02irismopidysnapcastspotify
Open Source Spotify client library
★ 6,739Rustupdated 2026-02-09librespotrustspotifyspotify-connect
High-performance Text-to-Speech server with OpenAI-compatible API, 8 voices, emotion tags, and modern web UI. Optimized for RTX GPUs.
★ 686Pythonupdated 2025-07-05ai-text-to-speechai-voiceartificial-intelligence
Fast Streaming TTS with Orpheus + WebRTC (with FastRTC)
★ 353Pythonupdated 2025-04-10
A command line utility to easily finetune XTTS models in a fully automated way. Developed for Pandrator.
★ 7Pythonupdated 2025-03-19fine-tuningpandratorttstts-enginextts
Generate audio datasets for training Text-To-Speech models, through smart audio splitting with silence detection, and transcription using Whisper.
★ 30Pythonupdated 2023-05-27
EaseVoice Trainer is a simple and user-friendly voice cloning and speech model trainer.
★ 351Pythonupdated 2025-04-23speech-trainingtext-to-speechttsvoice-cloning
XTTS fine-tuning via CLI
★ 1Pythonupdated 2025-10-16aiai-trainingaudioaudio-processingcoqui
Run Orpheus 3B Locally With LM Studio
★ 535Pythonupdated 2025-03-20aipythontext-to-speechtts
AI-powered tool for automatic podcast script and audio generation.
★ 83Pythonupdated 2025-08-14artificial-intelligencechatgptpodcast
Self-host the powerful Chatterbox TTS model. This server offers a user-friendly Web UI, flexible API endpoints (incl. OpenAI compatible), predefined voices, voice cloning, and large audiobook-scale text processing. Runs accelerated on NVIDIA (CUDA), AMD (ROCm), and CPU.
★ 1,187Pythonupdated 2026-04-02aiapi-serveraudio-generationchatterboxchatterbox-tts
Run on AMD graphics card
★ 9Pythonupdated 2026-02-13
StyleTTS 2: Towards Human-Level Text-to-Speech through Style Diffusion and Adversarial Training with Large Speech Language Models
★ 6,243Pythonupdated 2024-08-10adversarial-trainingdeep-learningdiffusion-modelsganlatent-diffusion
AI podcast generator
★ 3Vueupdated 2025-01-31
AI-Powered Podcast Generator: A Python-based tool that converts text scripts into realistic audio podcasts using Google's Generative AI API. This project leverages advanced text-to-speech technology to create dynamic, multi-speaker conversations with customizable voices.
★ 55Pythonupdated 2024-12-16gemini-2-0-flash-expgenerative-language-apigoogle-aigoogleapis
Python tool to automate Google NotebookLM podcast creation with website/YouTube sources
★ 31Pythonupdated 2025-05-30notebooklmpythonstreamlit
PageLM is a community driven version of NotebookLM & a education platform that transforms study materials into interactive resources like quizzes, flashcards, notes, and podcasts.
★ 1,574TypeScriptupdated 2026-03-27aidockeredtecheducationflashcards
The AI Podcast Studio: generate podcasts scripts and their audio version with a team of AI workers in a Podcast Studio 🎙️📜
★ 224Pythonupdated 2025-03-05ag2aiaudio-generationautogenelevenlabs
Automatically generate engaging AI podcasts from nothing but an episode title.
★ 144Pythonupdated 2025-07-28anthropicelevenlabsgeminilangchainllm
Open Source Podcast Publishing Solution (2006–2026)
★ 623PHPupdated 2026-04-04cmsfeeditunesitunes-podcast-feedphp
A multi-voice TTS system trained with an emphasis on quality
★ 14,844Jupyter Notebookupdated 2024-11-19
The ultimate training toolkit for finetuning diffusion models
★ 10,347Pythonupdated 2026-04-19
evtest displays information on the input device specified on the command line, i... (mirror)
★ 60Cupdated 2016-04-04
A Model Context Protocol (MCP) server that enables Claude Desktop to interact with Google's Gemini AI - featuring 7 tools with Smart Tool Intelligence that learns from your usage patterns
★ 17JavaScriptupdated 2025-12-02
The online tikkun you always wanted, but never had.
★ 70TypeScriptupdated 2026-04-16
The online tikkun you always wanted, but never had.
★ 1TypeScriptupdated 2025-11-27
Dockerized Whisper C++ speech-to-text API for easy deployment and rapid integration. Offering the latest stable and nightly builds for efficient audio transcription.
★ 28C++updated 2026-02-28apiaudio-transcriptiondockermachine-learningspeech-to-text
★ 38Cupdated 2026-04-17
Wyoming protocol server for openWakeWord wake word detection system
★ 200Pythonupdated 2025-10-30
wake word engine benchmark framework
★ 153Pythonupdated 2026-01-07benchmarkbenchmark-frameworkkeyword-spottingwake-wordwake-word-detection
★ 203updated 2026-04-20
A TensorFlow based wake word detection training framework using synthetic sample generation suitable for certain microcontrollers.
★ 819Pythonupdated 2025-12-21
Wyoming protocol server for the Whisper API speech to text system
★ 60Pythonupdated 2026-04-17
A lightweight Python package for Automatic Speech Recognition using ONNX models
★ 305Pythonupdated 2026-04-19asrlightweightonnxparakeetpython
Fast inference engine for Transformer models
★ 4,450C++updated 2026-02-04avxavx2cppcudadeep-learning
Real-time transcription using faster-whisper
★ 615HTMLupdated 2024-07-23faster-whisperopenaispeech-recognitionspeech-to-textvoice-recognition
Wyoming protocol server for faster whisper speech to text system
★ 319Pythonupdated 2026-03-25
:microphone: React Native Voice Recognition library for iOS and Android (Online and Offline Support)
★ 2,156TypeScriptupdated 2026-01-31androidiosreact-nativespeech-recognitionvoice-recognition
A fast, lightweight Linux tool that converts speech to text and types it into any window using OpenAI's Whisper API.
★ 1Rustupdated 2025-11-07
🎙️ Lightning-fast voice dictation Desktop Web App powered by Groq's Whisper Turbo - Open-source, privacy-first, with real-time audio visualization and intuitive click controls
★ 4Rustupdated 2026-03-14desktop-appdesktop-web-based-appgroqlinuxreal-time
A speedy unrestricted voice dictation tool on Linux that uses wipsper.
★ 1updated 2025-05-27
Cross-platform voice-to-text dictation for Linux and macOS. Local/private STT using Parakeet-TDT 1.1B with NVIDIA CUDA or Apple CoreML acceleration.
★ 11Makefileupdated 2026-03-24
Native speech-to-text for Linux - Fast, accurate and private system-wide dictation
★ 986Pythonupdated 2026-04-19aiarchlinuxcachyoscohere-aidebian
Microsoft PowerToys is a collection of utilities that supercharge productivity and customization on Windows
★ 132,035C#updated 2026-04-20advanced-pastecolor-pickercommand-palettedesktopfancyzones
A performant frontend ecommerce starter template with Next.js
★ 2,728TypeScriptupdated 2026-04-09cartcomposablecomposable-commercee-commerceecommerce
Voice input tool for Ubuntu 25.04 with Wayland. Record speech with hotkey, transcribe via Nexara API, and copy to clipboard.
★ 3JavaScriptupdated 2026-02-02
★ 1Rustupdated 2026-04-06
Voice-to-text input daemon for Linux using OpenAI Whisper
★ 1Pythonupdated 2025-10-05
Real-time AI dictation using faster-whisper—type anywhere with instant, accurate speech-to-text conversion.
★ 11Pythonupdated 2025-03-25
Effortless Push-to-Talk Transcription, Anywhere.
★ 27Pythonupdated 2026-04-05canarycanary-1b-v2coherecohere-transcribe-03-2026faster-whisper
Real-time voice input software using the Whisper model.
★ 17Pythonupdated 2025-07-19
A small script that types what you say using whisper while holding a hotkey
★ 15Pythonupdated 2025-11-19openaipython3speach-recognitionspeach-to-texttyping-assistant
A fully local, offline first speech-to-text application made for Linux!
★ 9Pythonupdated 2025-09-24
Wayland Speech-to-Text Tool - A minimal signal-driven speech-to-text tool for Wayland environments with PipeWire audio
★ 120Rustupdated 2026-03-21
LLM Council works together to answer your hardest questions
★ 17,710Pythonupdated 2025-11-22
Trigger.dev example projects that anyone can fork and run
★ 108TypeScriptupdated 2026-04-17examplesopensourcetypescript
A library for efficient similarity search and clustering of dense vectors.
★ 39,843C++updated 2026-04-20
Offline Voice Dictation & Text Enhancement A lightweight, 100% local Linux tool for real-time voice‑to‑text transcription and LLM‑powered writing improvements.
★ 1Shellupdated 2025-05-15
from microphone directly to your app
★ 1Rustupdated 2026-04-15aidictationlinuxllmwhisper
Cross-platform audio I/O library in pure Rust
★ 3,678Rustupdated 2026-04-19audiorustsound
A Linux / Gnome dictation app which uses fast whisper to do speach to text.
★ 4Pythonupdated 2026-01-09
Real-Time Transcription System for Niri - MacOS-like dictation for Linux Wayland environments
★ 4JavaScriptupdated 2026-02-14
macOS-style dictation for Ubuntu using Whisper. Press double-Ctrl, speak, and your words are transcribed to text locally with faster-whisper. Supports clipboard output, customizable hotkeys, and offline models for speed and privacy.
★ 1Pythonupdated 2025-09-24
An asyncronous resampling library written in Rust
★ 320Rustupdated 2026-04-01
Minimalist ML framework for Rust
★ 20,089Rustupdated 2026-04-19
Orchestrate Claude Code, Codex, and Gemini sessions on a multiplayer canvas. Manage git worktrees, track AI conversations, and visualize your team's agentic work in real-time.
★ 1,159TypeScriptupdated 2026-04-19
server that provides seamless integration with Tailscale's CLI commands and REST API, enabling automated network management and monitoring through a standardized interface
★ 87TypeScriptupdated 2026-02-03mcpmcp-serverstailscale
Highly Flexible Lovelace Card - arbitrary contents/columns/rows, regex matched, perfect to show appdaemon created content and anything breaking out of the entity_id + attributes concept
★ 264JavaScriptupdated 2026-01-29data-tabledata-visualizationflexible-tablehigh-configurabilityhome-automation
Lightning-Fast, On-Device, Multilingual TTS — running natively via ONNX.
★ 2,845C++updated 2026-01-22cppcsharpgoiosjava
Valdi is a cross-platform UI framework that delivers native performance without sacrificing developer velocity.
★ 16,383C++updated 2026-04-18androidcross-platformiostypescriptvaldi
An Open Source Python alternative to NotebookLM's podcast feature: Transforming Multimodal Content into Captivating Multilingual Audio Conversations with GenAI
★ 6,241Pythonupdated 2025-12-09elevenlabsgeminigenainotebooklmopenai
Silero Models: pre-trained text-to-speech models made embarrassingly simple
★ 5,888Jupyter Notebookupdated 2026-04-16armenianazerbaijanibelaruscolabgeorgian
Operating System for digital photo frames
★ 122Makefileupdated 2025-03-19
Self-hosted open-source web gallery to view your photos and videos featuring mobile-friendly, tagging and AI powered image discovery
★ 1,110JavaScriptupdated 2026-03-01calculate-previewsexifface-detectionface-recognitiongallery
Sora Digital Photo Frame - Turn any screen into a smart digital photo frame with ease
★ 74JavaScriptupdated 2026-01-12claude-codedigital-signagehome-automationjavascriptnodejs
https://hf.co/hexgrad/Kokoro-82M
★ 6,750JavaScriptupdated 2025-08-06
Memori is agent-native memory infrastructure. A LLM-agnostic layer that turns agent execution and conversation into structured, persistent state for production systems.
★ 13,868Pythonupdated 2026-04-17agentagent-memoryaiai-memoryaiagent
A set of ready to use Agent Skills for research, science, engineering, analysis, finance and writing.
★ 19,423Pythonupdated 2026-04-20agent-skillsai-scientistbioinformaticschemoinformaticsclaude
Local persistent memory store for LLM applications including claude desktop, github copilot, codex, antigravity, etc.
★ 4,020TypeScriptupdated 2026-04-19aiai-agentsai-infrastructureai-memoryartificial-intelligence
🌐 The all-in-one tool, for keeping track of your domain name portfolio. Got domain names? Get Domain Locker!
★ 1,313TypeScriptupdated 2026-03-16alternative-toautomationdashboarddockerdomain-investment
Agentic AI Infrastructure for magnifying HUMAN capabilities.
★ 11,778TypeScriptupdated 2026-04-12aiaugmentationhumansproductivity
Here's some output styles I've been using with claude code, they've consistently provided a more accurate and usable experience compared to vanilla claude code
★ 1updated 2025-09-18
Twidi Speech To Text (openai, push to talk, linux, wayland, deepgram)
★ 4Pythonupdated 2026-02-22deepgramopenaiopenai-apipush-to-talkspeech-to-text
Simple, safe way to store and distribute tensors
★ 3,724Pythonupdated 2026-04-19
Aivis Voice Model File (.aivm/.aivmx) Utility Library
★ 25Pythonupdated 2025-10-17aivis-projectaivmonnxpythonsafetensors
A utility to inspect, validate, sign and verify machine learning model files.
★ 67Rustupdated 2025-02-05ggufonnxpytorchsafetensors
Use safetensors with ONNX 🤗
★ 89Pythonupdated 2026-04-14onnxonnx-modelssafetensors
Repository of "CV Project" app. It's an unofficial app for Mozilla Common Voice, which permits you to contribute to this project via your device.
★ 114Kotlinupdated 2025-05-20androidcommon-voicehacktoberfestkotlin-androidmozilla
AllTalk is based on the Coqui TTS engine, similar to the Coqui_tts extension for Text generation webUI, however supports a variety of advanced features, such as a settings page, low VRAM support, DeepSpeed, narrator, model finetuning, custom models, wav file maintenance. It can also be used with 3rd Party software via JSON calls.
★ 2,331HTMLupdated 2026-01-09
Go ahead and axolotl questions
★ 11,770Pythonupdated 2026-04-20fine-tuningllm
Turn PDFs and EPUBs into audiobooks, subtitles or videos into dubbed videos (including translation), and more. For free. Pandrator uses local models, notably XTTS, including voice-cloning (instant, RVC-enhanced, XTTS fine-tuning) and LLM processing. It aspires to be a user-friendly app with a GUI, an installer and all-in-one packages.
★ 551Pythonupdated 2025-04-21audiobookaudiobook-creatoraudiobook-makeraudiobookscustomtkinterprojects
A desktop application for viewing and analyzing tabular data
★ 3,446TypeScriptupdated 2025-03-05csvdata-analysisdata-sciencedatabasedesktop-application
Official Code of Memento: Fine-tuning LLM Agents without Fine-tuning LLMs
★ 2,409Pythonupdated 2025-10-05
A powerful tool for creating datasets for LLM fine-tuning 、RAG and Eval
★ 14,068JavaScriptupdated 2026-04-10datasetfine-tuningjavascriptllmrag
Slightly improved official version for finetune xtts
★ 392Pythonupdated 2025-04-03
Fine-tuned whisper that transcribe Hebrew audio into IPA
★ 7Pythonupdated 2026-04-08g2phebrewipawhisper
🚀 Framework for seamless fine-tuning of Whisper model on a multi-lingual dataset and deployment to prod.
★ 38Pythonupdated 2025-02-27asrspeechspeech-recognitionspeech-to-textspeech-transcription
This repository contains code for fine-tuning the Whisper speech-to-text model.
★ 23Jupyter Notebookupdated 2026-04-16fine-tuningnlpspeech-to-textwhisper
🎒 Token-Oriented Object Notation (TOON) – Compact, human-readable, schema-aware JSON for LLM prompts. Spec, benchmarks, TypeScript SDK.
★ 24,021TypeScriptupdated 2026-04-16data-formatllmserializationtokenization
A remote Model Context Protocol (MCP) server for interacting with the dev.to public API without requiring authentication.
★ 44TypeScriptupdated 2025-10-09mcpmcp-servermcp-serverstypescript
☕ GPT-2 chatbot for daily conversation
★ 84Pythonupdated 2022-02-14chatbotgpt-2nlp
★ 186Jupyter Notebookupdated 2024-06-26
Take notes with your voice and send them to Notion
★ 144JavaScriptupdated 2026-03-06
A fully offline, high-performance, streaming speech-to-text tool for developers on Linux.
★ 3Pythonupdated 2025-10-24
Wispr-Lite: local voice dictation and command launcher for Linux Mint Cinnamon
★ 4Pythonupdated 2025-10-28
GPU-accelerated speech-to-text service that types what you say, powered by OpenAI's Whisper AI
★ 3Pythonupdated 2025-10-09accessibilitycudadictationgpu-accelerationlinux
Transform your Linux system into a powerful voice-controlled workstation with real-time dictation, AI-powered chat, and text enhancement capabilities.
★ 2Pythonupdated 2025-02-10
WhispAway, local dictation tool for Linux.
★ 13Rustupdated 2026-01-20
Record, transcribe, and transform voice notes into structured insights. Leverage Whisper or AssemblyAI and ChatGPT to fill in gaps, generate summaries, and visualize ideas — all seamlessly integrated within Obsidian.
★ 72TypeScriptupdated 2026-02-24assemblyaiobsidianopenaivoice-assistant
A Medical / Clinical Note Taking Demo Application using Deepgram Voice Agent API
★ 14TypeScriptupdated 2025-07-09
A simple frontend component for recording voice notes and converting them to structured shopping lists
★ 1TypeScriptupdated 2025-03-03
Take notes with your voice & transform them with AI
★ 496TypeScriptupdated 2026-03-03
ComfyUI Chatterbox TTS & Voice Conversion Node
★ 93Pythonupdated 2025-08-21
librechat.ai
★ 486MDXupdated 2026-04-15blogdocslibrechat
★ 23Pythonupdated 2025-02-25
Push-to-talk voice dictation for Linux. Record with PipeWire, transcribe locally via whisper.cpp, and type text into any app using ydotool. Fast, private, and works system-wide with a single hotkey.
★ 2Shellupdated 2025-10-20
voice-to-text dictation tool that allows you to type in any application on your Linux desktop simply by speaking
★ 2Pythonupdated 2025-08-14
Linux Live Dictation - Real-time speech-to-text with Whisper
★ 1Pythonupdated 2025-09-15
A voice recording and transcription tool for Hyprland, using Whisper for speech-to-text and copying results to clipboard. It's using Faster Whisper (optimized for CPU) and runs fully locally.
★ 11Pythonupdated 2026-01-03hyprlandhyprland-dotfileshyprland-ricewaylandwhisper
WhisperX-powered voice transcription tool that types text directly at your cursor position. Hold F9 to record, release to transcribe.
★ 26Pythonupdated 2026-03-04pytorchtranscriptionvoice-commandswhisperwhisperx
type 10x faster with ai assisted voice typing
★ 3Pythonupdated 2025-03-17
Simple voice typing for Wayland users
★ 6JavaScriptupdated 2025-04-11
Fill forms through your voice instead of typing.
★ 12Pythonupdated 2025-05-21
Voice to Text Online Notepad Professional, Accurate & Free Speech Recognition Text Editor Distraction-Free, Fast, Easy to Use Web App for Dictation & Typing
★ 11JavaScriptupdated 2026-02-14ant-designbootstraplocalstoragenpmpwa-app
Voice‑powered typing for Wayland/Hyprland desktops
★ 211Goupdated 2026-04-17
MCP for the National Library of Israel - AI-powered bridge for exploring millions of cultural, historical, and literary assets.
★ 3Pythonupdated 2025-08-26aiapiclaudeclaude-aiclaude-desktop
MCP server for getting information about disability permitted cars in Israel
★ 1updated 2025-06-26
Model Context Protocol (MCP) server for accessing the Israeli Knesset's parliamentary information API
★ 1TypeScriptupdated 2025-04-14
A Personal Financial Data MCP Server over the israeli-bank-scrapers package
★ 10TypeScriptupdated 2025-11-20
MCP server for querying Israeli real estate sales data by AI agents
★ 3Pythonupdated 2025-12-08
A Model Context Protocol (MCP) server that demonstrates how to scrape financial data using the israeli-bank-scrapers library
★ 2JavaScriptupdated 2025-05-06
Real-time Israeli public transit MCP server with Google Routes, Places, GTFS, and Curlbus integration
★ 2Pythonupdated 2025-09-01
IMS (Israeli Meteorological Service) MCP Server
★ 1Pythonupdated 2026-02-04
MCP Server for Israel budget
★ 2Pythonupdated 2025-04-29
A Model Context Protocol (MCP) server that provides financial data access through automated Israeli bank and credit card data scraping. Supports all major Israeli financial institutions dynamically based on your configuration
★ 8TypeScriptupdated 2025-06-13
MCP server providing access to Israeli Ministry of Health data dashboard APIs.
★ 2Pythonupdated 2025-05-15
A Model Context Protocol (MCP) server that provides programmatic access to Israeli Land Authority (רמ״י) public tender data.
★ 14Pythonupdated 2025-09-17
Israel Statistics MCP
★ 3TypeScriptupdated 2025-08-24
★ 17TypeScriptupdated 2025-08-31aianthropicclaudedrugshealthcare
Advanced MCP server for seamless access to Israeli Government Open Data
★ 64JavaScriptupdated 2025-08-31aiclaudedata-gov-ilgovernment-dataisrael
Add context menu to Dolphin to easily open VS Code at location on right click.
★ 57Shellupdated 2026-03-26
A benchmark for LLMs on complicated tasks in the terminal
★ 2,081Pythonupdated 2026-01-22
An extensive node suite for ComfyUI with over 210 new nodes
★ 198Jupyter Notebookupdated 2025-09-26
Custom nodes for using fal API.
★ 182Pythonupdated 2026-03-19comfyuifluxkling
Run Replicate models as nodes in ComfyUI
★ 207Pythonupdated 2024-11-05aicomfy-uicomfyuicomfyui-nodesreplicate
ComfyUI custom nodes and web utilities for real-time AI generation and interaction
★ 347Pythonupdated 2026-03-26aigcartcomfyui-nodes
This extension serves as a complement to the Impact Pack, offering features that are not deemed suitable for inclusion by default in the ComfyUI Impact Pack
★ 338Pythonupdated 2025-07-22
A ComfyUI custom node integration for local multi-engine multi-language Text-to-Speech and Voice Conversion. Supports: RVC, Echo-TTS, Qwen3-TTS, Cozy Voice 3, Step Audio EditX, IndexTTS-2, Chatterbox (classic and multilingual), F5-TTS, Higgs Audio 2 and VibeVoice with unlimited text length, SRT timing, Character support, and many audio tools
★ 891Pythonupdated 2026-04-17ai-audioaudioaudio-editingaudio-generationaudio-processing
An image/video/workflow browser and manager for ComfyUI.
★ 659Svelteupdated 2024-11-11comfyuicomfyui-browsercomfyui-managerstable-diffusionworkflows
★ 817Pythonupdated 2025-10-23
This repository offers various extension nodes for ComfyUI. Nodes here have different characteristics compared to those in the ComfyUI Impact Pack. The Impact Pack has become too large now...
★ 779Pythonupdated 2025-11-17
LoRA Manager for ComfyUI - A powerful extension for organizing, previewing, and integrating LoRA models with metadata and workflow support.
★ 1,101Pythonupdated 2026-04-20
ControlNet scheduling and masking nodes with sliding context support
★ 965Pythonupdated 2026-03-30
★ 1,101Pythonupdated 2025-04-14
★ 1,134Pythonupdated 2025-04-02
A comprehensive ComfyUI integration for Microsoft's VibeVoice text-to-speech model, enabling high-quality single and multi-speaker voice synthesis directly within your ComfyUI workflows.
★ 1,466Pythonupdated 2026-02-18ai-audioai-ttsai-voiceai-voice-cloneai-voice-clonining
Nodes related to video workflows
★ 1,603Pythonupdated 2026-04-14
A ComfyUI workflows and models management extension to organize and manage all your workflows, models in one place. Seamlessly switch between workflows, as well as import, export workflows, reuse subworkflows, install models, browse your models in a single workspace
★ 1,430TypeScriptupdated 2025-04-16comfyui
A ComfyUI custom node designed for advanced image background removal and object, face, clothes, and fashion segmentation, utilizing multiple models including RMBG-2.0, INSPYRENET, BEN, BEN2, BiRefNet, SDMatte, SAM, SAM2, SAM3 and GroundingDINO.
★ 1,899Pythonupdated 2026-02-03comfyuicomfyui-nodesimagemaskremove-background
In order to make it easier to use the ComfyUI, I have made some optimizations and integrations to some commonly used nodes.
★ 2,485Pythonupdated 2026-04-09
Improved AnimateDiff for ComfyUI and Advanced Sampling Support
★ 3,440Pythonupdated 2026-03-30
Custom nodes pack for ComfyUI This custom node helps to conveniently enhance images through Detector, Detailer, Upscaler, Pipe, and more.
★ 3,081Pythonupdated 2026-04-19
An extensive node suite that enables ComfyUI to process 3D inputs (Mesh & UV Texture, etc) using cutting edge algorithms (3DGS, NeRF, etc.)
★ 3,720Pythonupdated 2025-12-29comfycomfyuimachine-learning
★ 5,921Pythonupdated 2025-04-14
A memory-efficient implementation for upscaling videos in ComfyUI using non-diffusion upscaling models. This custom node is designed to handle large video frame sequences without memory bottlenecks.
★ 121Pythonupdated 2025-09-18
A powerful ComfyUI node for text-based image editing using Black Forest Labs' Flux Kontext API.
★ 82Pythonupdated 2025-06-10
🐍📦 Ultra-fast Python package for calculating and analyzing the Word Error Rate (WER). Built for the scalable evaluation of speech and transcription accuracy.
★ 26Pythonupdated 2026-03-30asrasr-evaluationautomatic-speech-recognitionlevenshtein-distancemetrics
Omnilingual ASR Open-Source Multilingual SpeechRecognition for 1600+ Languages
★ 2,780Pythonupdated 2025-12-30
MeetEval - A meeting transcription evaluation toolkit
★ 154Pythonupdated 2026-01-27asrderwer
Open-Source Speech-to-Text Evaluation Framework
★ 2Jupyter Notebookupdated 2025-02-12llm-evaluationllm-inferencespeech-to-text
RocM Optimized ComfyUI nodes
★ 30Pythonupdated 2026-03-08
Get started using Deepgram's Live Transcription with this Next.js demo app
★ 270TypeScriptupdated 2026-04-10deepgramlivereal-timespeech-to-textstt
An open-source database of AI models.
★ 3,517TypeScriptupdated 2026-04-20
Official Jina AI Remote MCP Server
★ 655TypeScriptupdated 2026-03-14mcpmcp-server
Linux alternative to Wispr Flow for vibe coding with Cursor but works with any app. Uses OpenAI optionally for dictation clean up.
★ 5Pythonupdated 2026-02-27
Voice dictation for Linux/Wayland (like wisprflow). 100% offline, GPU-accelerated, and actually works with Wayland compositors.
★ 4Pythonupdated 2025-10-09dictationlinuxopenaiwaylandwhisper
AudioWrite: Effortless voice dictation powered by Google's Gemini API. Record, transcribe, and transform rambling audio into polished, multi-language notes. PWA ready.
★ 5TypeScriptupdated 2026-01-05aiaudio-recorderdictationfrontendgemini-api
Your voice - VocalFlow dictation, harnessing Whisper and faster-whisper for real-time transcription, adaptive learning, and NLP. Built with Python, it spans Linux, Windows, and macOS, boosting productivity through voice-assisted workflows.
★ 3Pythonupdated 2025-09-08cross-platformdesktop-appdictationfaster-whisperlinux
A user-friendly voice dictation application for Linux that supports multiple languages.
★ 3Pythonupdated 2025-11-03accessibilitydictationlinuxmultilingualproductivity
Turn CAPSLOCK key into Dictation Key
★ 19Shellupdated 2025-06-09asrdictationspeech-recognitionspeech-to-textvoice
This is a python script using whisper to type with your voice
★ 67Pythonupdated 2025-07-18
VoiceTyper-Pro is an advanced speech-to-text dictation tool built with Python and powered by the Deepgram API. Alternative to Mac Whisper, Voice Access, and other voice typing tools.
★ 40Pythonupdated 2025-02-22deepgrammacvoice-recognitionwhisperwhisper-ai
★ 24TypeScriptupdated 2025-10-28
Indelible links
★ 506JavaScriptupdated 2026-04-09librariesweb-archiving
Transcribe and summarize videos and podcasts using AI. Open-source, multi-platform, and supports multiple languages.
★ 2,548Pythonupdated 2026-03-07aitooltiktoktranscribevideototextyoutube
★ 129TypeScriptupdated 2025-11-24
Control Gmail, Google Calendar, Docs, Sheets, Slides, Chat, Forms, Tasks, Search & Drive with AI - Comprehensive Google Workspace / G Suite MCP Server & CLI Tool
★ 2,211Pythonupdated 2026-04-17aig-suitegmailgoogle-calendargoogle-chat
Postgres MCP Pro provides configurable read/write access and performance analysis for you and your AI agents.
★ 2,618Pythonupdated 2026-01-22
🔥 1Panel is a modern, open-source VPS control panel — and the only one with native AI agent support. Run Ollama models, deploy OpenClaw agents, and manage your entire server stack from one clean web interface.
★ 35,173Goupdated 2026-04-20agentclawdbotcopawdockerdocker-ui
MCP integration for Google Calendar to manage events.
★ 1,101TypeScriptupdated 2026-03-30
🤖 A visualization mcp & skills contains 25+ visual charts using @antvis. Using for chart generation and data analysis.
★ 4,016TypeScriptupdated 2026-02-25antvllmmcpmcp-serverskills
UI over MCP. Create next-gen UI experiences with the protocol and SDK!
★ 4,685TypeScriptupdated 2026-03-12aifrontendllmmcpui
Development platform to debug, chat, inspect, and evaluate MCP servers, MCP apps, and ChatGPT apps.
★ 1,888TypeScriptupdated 2026-04-20anthropicchatgptcicddebuggerevals
Claude Code extension manager — MCP servers, plugins (skills, hooks, agents), and marketplaces
★ 72TypeScriptupdated 2026-04-18anthropicclaudeclaude-codeclimarketplaces
A set of tools to connect to AI agents, to allow them to use Todoist on a user's behalf. Includes MCP support.
★ 463TypeScriptupdated 2026-04-20
Large Language Model Text Generation Inference
★ 10,844Pythonupdated 2026-03-21bloomdeep-learningfalcongptinference
Run AI models locally on your machine with node.js bindings for llama.cpp. Enforce a JSON schema on the model output on the generation level
★ 2,019TypeScriptupdated 2026-04-12aibindingscataicmakecmake-js
Real-time webcam demo with SmolVLM and llama.cpp server
★ 5,543HTMLupdated 2025-05-12
A lightweight Model Context Protocol (MCP) server that provides persistent bookmark management for Claude and other MCP-compatible clients. Features categorized storage, resource discovery, and seamless integration with your AI workflow.
★ 12TypeScriptupdated 2025-09-13aibookmark-managerdockermcpmcp-server
CLI tool for managing Model Context Protocol (MCP) servers in one place & using them across them different clients
★ 25Pythonupdated 2025-04-23artificial-intelligenceclimcpmcp-clientmcp-server
Simple MCP Manager Desktop Application
★ 44Pythonupdated 2025-08-26desktop-appmcppyqt6python3
A task management MCP server that provides comprehensive project and task tracking capabilities
★ 35Pythonupdated 2025-04-16
mcp store manager, add & syncs MCP server configurations across clients like Claude code, Cursor💡mcphub
★ 308TypeScriptupdated 2026-04-17aiawesomeclaudedxtllm
A web-based GUI tool for managing Model Context Protocol (MCP) servers in Claude and Cursor
★ 66JavaScriptupdated 2024-12-17mcp
CLI MCP package manager & registry for all platforms and all clients. Search & configure MCP servers. Advanced Router & Profile features.
★ 933Pythonupdated 2026-03-27aiclaude-desktopcliclinecontinue
❤️ Generate mermaid diagram and chart with AI MCP dynamically.
★ 534TypeScriptupdated 2026-03-28mcpmcp-servermermaidmermaidjs
LLM Gateway to call 100+ LLM APIs in OpenAI format with MCP supported.
★ 31Goupdated 2025-10-02
A gateway service designed to manage and orchestrate OpenAI-compatible API servers with MCP support.
★ 13Rustupdated 2026-01-12gatewaymcpmcp-clientopenai
Open Source MCP gateway and proxy for Model Context Protocol (MCP) servers with enterprise authentication and service discovery
★ 22Pythonupdated 2025-09-03mcp-gatewaymcp-server
MCP OAuth Proxy incl. dynamic client registration (DCR), MCP prompt analytics and MCP firewall to build enterprise grade MCP servers.
★ 93Goupdated 2026-04-19agentsapi-gatewayauthentication-middlewaredevopsdex
A list of MCP gateways
★ 118Pythonupdated 2026-04-03awesomeawesome-liste2bmcpmcp-gateway
The Grafbase GraphQL Federation Gateway
★ 1,227Rustupdated 2026-04-19aiapienterprise-graphqlfederationgraphql
Turn a web server into an MCP server in one click without making any code changes.
★ 170Rustupdated 2026-03-11gatewaymcpmcp-serversproxy
A plugin-based gateway that orchestrates other MCPs and allows developers to build upon it enterprise-grade agents.
★ 367Pythonupdated 2026-01-22agentagent-securitygatewaygen-aigenai
Run MCP stdio servers over SSE and SSE over stdio. AI gateway.
★ 2,589TypeScriptupdated 2025-10-09
MCP Gateway is a reverse proxy and management layer for MCP servers, enabling scalable, session-aware stateful routing and lifecycle management of MCP servers in Kubernetes environments.
★ 599C#updated 2026-04-16aiapi-gatewayarm-deploymentsasp-net-coreazure
🧩 MCP Gateway - A lightweight gateway service that instantly transforms existing MCP Servers and APIs into MCP servers with zero code changes. Features Docker deployment and management UI, requiring no infrastructure modifications.
★ 2,095TypeScriptupdated 2026-04-17awesomemcpmcp-adaptermcp-gatewaymcp-server
Enterprise-ready MCP Gateway & Registry that centralizes AI development tools with secure OAuth authentication, dynamic tool discovery, and unified access for both autonomous AI agents and AI coding assistants. Transform scattered MCP server chaos into governed, auditable tool access with Keycloak/Entra integration.
★ 608Pythonupdated 2026-04-19a2aagentic-aiagentsansdocumentdb
Enterprise AI Platform with guardrails, MCP registry, gateway & orchestrator
★ 3,600TypeScriptupdated 2026-04-20a2aa2a-mcpacpagentai
MCP Aggregator, Orchestrator, Middleware, Gateway in one docker
★ 2,249TypeScriptupdated 2026-02-08mcpmcp-gatewaymcp-hostmcp-middlewaremcp-server
Universal MCP-Server for your Databases optimized for LLMs and AI-Agents.
★ 523Goupdated 2025-07-18amazon-bedrockanthropic-claudeapiautomatic-apiclickhouse
Brings MCP to ChatGPT, DeepSeek, Perplexity, Grok, Gemini, Google AI Studio, OpenRouter, DeepSeek, T3 Chat and more...
★ 2,435TypeScriptupdated 2026-02-09aistudioassistantchatgptdeepseekgemini
A unified hub for centrally managing and dynamically orchestrating multiple MCP servers/APIs into separate endpoints with flexible routing strategies
★ 2,034TypeScriptupdated 2026-04-19mcpmcp-gatewaymcp-hubmcp-routermcp-server
A Model Context Protocol (MCP) server that provides structured spec-driven development workflow tools for AI-assisted software development, featuring a real-time web dashboard and VSCode extension for monitoring and managing your project's progress directly in your development environment.
★ 4,143TypeScriptupdated 2026-03-07
A Unified MCP Server Management App (MCP Manager).
★ 1,976TypeScriptupdated 2026-01-24llmllmopsmcpmcp-clientmcp-manager
Connect Supabase to your AI assistants
★ 2,640TypeScriptupdated 2026-04-20
MCP server that interacts with Obsidian via the Obsidian rest API community plugin
★ 3,481Pythonupdated 2025-06-28
docker mcp CLI plugin / MCP Gateway
★ 1,365Goupdated 2026-04-15
Enable AI agents to work reliably - giving them secure access to structured data, tools to take action, and the context needed to make smart decisions.
★ 396TypeScriptupdated 2026-04-20agentscopilotmcpmcp-servermonday
Chrome DevTools for coding agents
★ 37,223TypeScriptupdated 2026-04-20browserchromechrome-devtoolsdebuggingdevtools
Manage multiple Claude Code accounts with usage tracking & load balancing.
★ 22Pythonupdated 2026-02-12
A lightweight CLI tool for seamlessly switching between multiple authentication accounts for AI services like Codex, Claude, and other applications.
★ 14Goupdated 2026-01-03
Account Switcher for Claude Code
★ 403Shellupdated 2025-07-01
Professional slash commands for Claude Code that provide structured workflows for software development tasks including code review, feature creation, security auditing, and architectural analysis.
★ 1,195Shellupdated 2026-03-01ai-toolsanthropicclaude-codecli-toolscode-review
All powerful skills of ClaudeKit.cc!
★ 2,035Pythonupdated 2026-04-03
The contents of /mnt/skills in Claude's code interpreter environment
★ 921updated 2025-12-12
An agentic skills framework & software development methodology that works.
★ 167,814Shellupdated 2026-04-16
Generic command-line automation tool
★ 2,188Cupdated 2025-12-22
VOXD is a speech-to-text, voice-typing, dictation software for linux distributions. It is an open-source, free of charge, USER-FRIENDLY software, for as many linux distros as possible.
★ 243Pythonupdated 2025-10-22ai-transcriptiondictationlinuxopen-sourceuser-friendly
:brain: 100% Local Memory layer and Knowledge base for agents with WebUI
★ 811Goupdated 2026-04-15
Faster whisper Running on AMD GPUs with modified CTranslate 2 Libraries served up with Wyoming protocol
★ 36Pythonupdated 2024-08-17
insanely-fast-whisper with support for AMD GPU's with rocm 6.1 - 7.1
★ 48Pythonupdated 2026-04-18
A full-featured, hackable Next.js AI chatbot built by Vercel
★ 20,184TypeScriptupdated 2026-04-17aichatgptnextjsreactredis
Entity Relation Diagrams generation tool
★ 1,406Pythonupdated 2026-01-12databasedocumentation-toolmysqlpostgresqlschema
Visual testing tool for MCP servers
★ 9,559TypeScriptupdated 2026-04-18
A tool to OCR PDFs using gen-AI models
★ 57Pythonupdated 2026-04-07aigptgroqhacktoberfestocr
The media player for language learning, with dual subtitles, AI-generated subtitles, real-time translation, and more!
★ 3,657C#updated 2026-04-19asrcsharpflyleaflanguage-learningllm
Opperator is a framework for building and running general AI agents locally from your terminal
★ 161Goupdated 2026-03-28
An index of the LangChain + LangGraph ecosystem: concepts, projects, tools, templates, and guides for LLM & multi-agent apps.
★ 1,736JavaScriptupdated 2026-04-14aiawesomeawesome-listlangchainlanggraph
The official MCP server to send emails and interact with Resend
★ 504TypeScriptupdated 2026-04-20
Whisper as a Service (GUI and API with queuing for OpenAI Whisper)
★ 2,066JavaScriptupdated 2026-04-17
Linux voice transcription with hotkey using faster-whisper (local) with optional GPT-4o mini polishing
★ 1Pythonupdated 2026-04-16dictationlinuxparakeetpush-to-talkspeech-to-text
Privacy‑first, real‑time speech‑to‑text dictation. 100% local inference in Rust; hotkey to dictate anywhere (macOS, Linux, Windows).
★ 22Rustupdated 2025-12-15cpalcross-platformdesktop-appdictationrust
Real-time desktop audio transcription using OpenAI Whisper for Arch Linux with CUDA acceleration
★ 3Pythonupdated 2025-08-05
Linux log interpreter using AI
★ 1Pythonupdated 2025-05-10
Pure C wrapper library to use Whisper.cpp with Linux and Windows as simple as possible.
★ 7C++updated 2025-09-17speech-to-textsttwhisperwhisper-cpp
Simple GUI around whisper.cpp for voice-to-text on Linux
★ 67Pythonupdated 2026-04-08dictationlinuxopenaipromptvoice
The most comprehensive authentication framework
★ 27,993TypeScriptupdated 2026-04-19authenticationiamoauthoauth2oidc
This repository contains implementations and illustrative code to accompany DeepMind publications
★ 14,873Jupyter Notebookupdated 2026-04-13
Tongyi Deep Research, the Leading Open-source Deep Research Agent
★ 18,746Pythonupdated 2026-02-27agentalibabaartificial-intelligencedeep-researchdeepresearch
React web app that lets creators generate AI images and 3D models using free services like AI Horde and HuggingFace. Built with Vite and ShadCN UI. https://justaaa.fyrean.com
★ 21JavaScriptupdated 2024-12-17
AI-powered web app that automatically generates resumes based on GitHub or LinkedIn profiles using LLM.
★ 9C#updated 2025-08-03ai-apiaspnet-coreazuredockerfastapi
An open-source AI content search engine designed specifically for content creators. Supports extraction of text, images, and short videos. Allows full local deployment (web app, RAG server, LLM server). Supports multi-modal RAG content Q&A.
★ 619TypeScriptupdated 2026-04-09contentcontent-searchragsearchsearch-engine
An AI-powered content generator app using NextJs, React, TailwindCss, Drizzle, Typescript, Gemini, and Clerk. Implement authentication, built a modern UI, set up a Postgres database, and utilised Google Gemini API to generate content with.
★ 31TypeScriptupdated 2025-03-07clerk-authclerkjsdrizzle-ormgemini-apineondb
Flet enables developers to easily build realtime web, mobile and desktop apps in Python. No frontend experience required.
★ 15,966Pythonupdated 2026-04-19androidcross-platformdesktopflutterios
A modern and customizable python UI-library based on Tkinter
★ 13,317Pythonupdated 2026-02-24customdark-modedark-themedpi-scalingfrontend-app
Image tracking, Location Based AR, Marker tracking. All on the Web.
★ 5,936JavaScriptupdated 2026-04-15aframearaugmented-realityhacktoberfesthacktoberfest2020
250+ Fine-tuning & RL Notebooks for text, vision, audio, embedding, TTS models.
★ 5,279Jupyter Notebookupdated 2026-04-18unsloth
🐸 - A general purpose model trainer, as flexible as it gets
★ 234Pythonupdated 2024-03-07aidata-sciencedeep-learningmachine-learningpytorch
A ComfyUI custom node for Google's Gemini 2.5 Flash Image (aka "Nano Banana") model - the state-of-the-art image generation and editing AI that went viral for its incredible quality and capabilities.
★ 77Pythonupdated 2025-08-27
A Nano Banana MCP server, which you can integrate to cursor/claude code and any mcp client
★ 182JavaScriptupdated 2025-11-04
Self-correcting image generation for Gemini's Nano Banana model
★ 37Pythonupdated 2025-10-09
A curated list of awesome Gemini Nano Banana model cases, prompts, and sources
★ 72updated 2025-08-29
from Google AI Studio
★ 156TypeScriptupdated 2025-09-19
🍌 The official starter kit for the Nano Banana Hackathon. Clone this repo to get building fast!
★ 1,024Jupyter Notebookupdated 2025-09-08
A curated collection of fun and creative examples generated with Nano Banana & Nano Banana Pro🍌, Gemini-2.5-flash-image based model. We also release Nano-consistent-150K openly to support the community's development of image generation and unified models(click to website to see our blog)
★ 22,396updated 2025-12-12awesomegemini-2-5-flash-imagenano-banana
An AI powered image editing tool for Linux desktops to enhance lighting on people in photographs.
★ 58Pythonupdated 2026-03-11aiappimagebeewaredebiangui-application
A Replicate AI Plugin for GIMP. Supports Nano Banana, Seedream4 and more.
★ 133Pythonupdated 2026-02-28
MakeHuman 2 should replace MakeHuman 1 in the future. The status is pre-alpha now.
★ 49Pythonupdated 2026-04-11
Structure from motion pipeline (Bundler + CMVS + PMVS2) ready to run on Docker
★ 30Pythonupdated 2025-06-20bundler-sfmcmvslinuxphotogrammetrypmvs2
COLMAP - Structure-from-Motion and Multi-View Stereo
★ 11,539C++updated 2026-04-19computer-visiongeometrymulti-view-stereoreconstructionstructure-from-motion
Using traditional image processing techniques to construct 3D point cloud of objects. Incremental Structure from Motion (SfM) is used, a popular SfM algorithm for 3D reconstruction for reconstruction. The method is then evaluated using certain 3D reconstruction datasets.
★ 138Pythonupdated 2022-05-01opencv-pythonsfm
Remove Backgrounds With AI & GIMP 3
★ 5Pythonupdated 2025-07-27
Suite of gimp plugins for texture synthesis
★ 1,797Cupdated 2026-04-14gimp-plugininpaintingstyle-transfertexture-synthesis
GIMP plug-ins, scripts and helpers
★ 207Pythonupdated 2025-12-30
GIMP AI plugins with OpenVINO Backend
★ 766Pythonupdated 2026-03-17
AI for GNU Image Manipulation Program
★ 1,542Pythonupdated 2024-10-12coloring-imagecomputer-visioncomputervisiondeblurringdeep-learning
converts between Hebrew and Gregorian dates using Rata Die (R.D.) algorithm by Dershowitz and Reingold
★ 3TypeScriptupdated 2026-04-10
perpetual Jewish Calendar with holidays, Shabbat and holiday candle lighting and havdalah times, Torah readings, and more
★ 122TypeScriptupdated 2026-04-20calendardaf-yomihebrew-calendarhebrew-dateholidays
Public repository for Agent Skills
★ 123,938Pythonupdated 2026-04-16agent-skills
★ 853Shellupdated 2026-04-20
Collection of LADSPA/LV2/VST/JACK audio plugins for high-quality processing
★ 306C++updated 2026-04-05audio-plugindpflv2lv2-pluginvst
The SWH Plugins package for the LADSPA plugin system
★ 246Cupdated 2024-05-24
Tests for using multiple different frameworks to replicate "Deep Agents" aka multi-agent systems that run on long tasks (such as Claude Code, OpenAI Deep Research, Manus, etc.)
★ 1Pythonupdated 2025-08-03
deep-learning-research-sub-agents for claude code
★ 1updated 2025-08-30
Deep Research System - Graph of Thoughts Implementation with multiple agents in claude code enviroment.
★ 3updated 2025-10-30
Cerno is a local-first research platform that leverages agentic AI to break down complex queries into verifiable, multi-step workflows. Switch seamlessly between cloud LLMs and self-hosted models, track every reasoning step, and optimize cost and tokens—all while keeping your data on your machine.
★ 66Pythonupdated 2025-09-11agentic-aiagentsanthropicautonomous-agentsclaude
Local RAG server for code editors. Scans your codebase, builds a local context index, and connects to any external LLM for context-aware completions and assistance.
★ 44Pythonupdated 2025-09-11ai-assistantclaudecodegendeepseekgemini
🌟 Build beautiful, accessible, high-performance documentation websites with Astro
★ 8,371TypeScriptupdated 2026-04-20astrodocs-generatordocumentationstarlightstatic-site-generator
⭕️ AstroWind: A free template using Astro 5 and Tailwind CSS. Astro starter theme.
★ 5,615Astroupdated 2025-08-19astroastro-blogastro-starterastro-templateastro-theme
🚀 High-performance image and video delivery and uploading at scale in Astro powered by Cloudinary.
★ 31TypeScriptupdated 2025-11-13astroastro-loadercloudinarycloudinary-sdk
Photo library and interactive editor built with Next.js & Cloudinary
★ 148TypeScriptupdated 2024-06-25
"AI-Trader: 100% Fully-Automated Agent-Native Trading"
★ 13,739Pythonupdated 2026-04-20
An open source user-empowering data visualization Vue 3 components library for eloquent data storytelling
★ 2,367Vueupdated 2026-04-20chartscomponents-librarydashboarddata-storytellingdata-visualization
Plots from the book "Storytelling with data" implementation using Python and matplotlib
★ 388Jupyter Notebookupdated 2023-09-26matplotlibpython
Generate static HTML photo / video galleries
★ 852JavaScriptupdated 2026-02-28galleryphotographyphotosstatic-site-generatorstatic-website
a headless CMS for photographers
★ 4Goupdated 2022-09-26cmsgogolangmysqlreactjs
:file_folder: File Management Platform / Universal Data Access Layer (without FUSE)
★ 14,106Goupdated 2026-04-20archivingazuredmsdropboxedrms
★ 42TypeScriptupdated 2026-02-17
A collection of awesome TypeScript resources for client-side and server-side development. Write your awesome JavaScript in TypeScript
★ 5,093updated 2026-02-11
🐢 A collection of awesome browser-side JavaScript libraries, resources and shiny things.
★ 34,950updated 2026-04-02
Super Productivity is an advanced todo list app with integrated Timeboxing and time tracking capabilities. It also comes with integrations for Jira, GitLab, GitHub and Open Project.
★ 18,843TypeScriptupdated 2026-04-20androidflowmodoroflowtimehabit-trackerios
A Model Context Protocol (MCP) server that provides tools for fetching Reddit content, including frontpage posts, subreddit information and hot posts, post details, and comments.
★ 174Pythonupdated 2025-04-14
Langflow-based LLM agent that keeps track of my personal projects. Based on integration with WhatsApp voice messages, Whisper, OpenAI/Mistral models and local MCP.
★ 1Pythonupdated 2025-06-22
The ultimate PyQt6 application that integrates the power of OpenAI, Google Gemini, Claude, and other open-source AI models
★ 7Pythonupdated 2025-12-07agentchatgptclaudedalleevaluator-optimizer-workflow
A Model Context Protocol (MCP) server that provides ASR(Automatic Speech Recognition) capabilities using the whisper engine. This server exposes TTS functionality through MCP tools, making it easy to integrate speech synthesis into your applications.
★ 1Pythonupdated 2025-03-31
A powerful audio transcription server that seamlessly transcribes meeting recordings, generates notes, and intelligently splits audio files for efficient management. Open-source and built with FastMCP and Groq/OpenAI Whisper
★ 3Pythonupdated 2025-06-13
A powerful MCP (Model Context Protocol) server that transcribes audio and video files into text using Groq's Whisper model.
★ 2Pythonupdated 2025-06-10
Whisper + TTS + As many MCP servers as I can stuff in
★ 1Pythonupdated 2025-05-01
MCP server for real-time audio transcription using OpenAI Whisper
★ 3TypeScriptupdated 2025-10-08
🗣️ Whispers Talk. Recall. Repeat. A blazing-fast voice journal that remembers everything you say — searchable with AI. ✨ What is Whispers? Whispers is a voice-first journaling app powered by: 🧠 <300ms Latency Streaming Transcription (AssemblyAI) 🔍 Algolia MCP for instant search of your thoughts
★ 4TypeScriptupdated 2025-07-28
Blazingly fast audio transcription MCP server using Whisper with Flash Attention 2
★ 1Pythonupdated 2025-12-04
mcp server for whisper-cli
★ 1Pythonupdated 2025-07-18
🎙️ AI Dictation App - Open Source and Local-first ⚡ Type 3x faster, no keyboard needed. 🆓 Powered by open source models, works offline, fast and accurate.
★ 1,176TypeScriptupdated 2026-04-18aiai-note-taking-appasrdictatedictation
A high-performance Model Context Protocol (MCP) server providing local speech-to-text transcription using whisper.cpp, optimized for Apple Silicon.
★ 13TypeScriptupdated 2025-06-03appleapple-siliconm1m2m3
A MCP server that provides audio transcription capabilities using OpenAI's Whisper API
★ 9JavaScriptupdated 2025-03-25
A high-performance speech recognition MCP server based on Faster Whisper, providing efficient audio transcription capabilities.
★ 17Pythonupdated 2025-03-22
A push-to-talk wisper-flow service to support voice-base vibe-coding with claude
★ 2Pythonupdated 2026-04-15
Comprehensive MCP server providing real-time framework documentation access for Claude Code with intelligent caching, multi-source integration, and context-aware assistance.
★ 120TypeScriptupdated 2026-03-13ai-toolsasynccachingclaude-codedeveloper-tools
Deprecated: Use the remote MCP server at https://mcp.sanity.io instead.
★ 73updated 2026-02-06cmsmcpmcp-server
List MCP Server configurations in your system used by AI applications like Cursor, Claude Desktop, VS Code and others
★ 80TypeScriptupdated 2026-04-10claude-aiclaude-desktopcursorcursor-aimcp
Awesome Claude Code plugins — a curated list of slash commands, subagents, MCP servers, and hooks for Claude Code
★ 711Pythonupdated 2025-10-14awesome-claude-codeawesome-listawesome-pluginsawesome-resourcesclaude-code
The most accurate and comprehensive Context Engine as a service, optimized for large codebases, powered by advanced GraphRAG and accessible via MCP. It enriches the context for AI agents like Codex, Claude Code, Cursor, etc., making them 35% more efficient and up to 84% faster.
★ 78Pythonupdated 2026-04-17claude-codecursorgraphraglarge-codebasemcp
[DEPRECATED] Superseded by systempromptio/systemprompt-template and systempromptio/systemprompt-core. MCP server for orchestrating AI coding agents (Claude Code CLI & Gemini CLI).
★ 139TypeScriptupdated 2025-07-03aiclaude-codegemini-climcpmcp-server
MCP server for generating beautiful code screenshots directly from Claude
★ 44TypeScriptupdated 2025-11-06claude-codecodescreenshotmcpmcp-server
A starting point for Claude Code to Codex collaboration
★ 39updated 2026-02-21
DeepContext is an MCP server that adds symbol-aware semantic search to Claude Code, Codex CLI, and other agents for faster, smarter context on large codebases.
★ 275TypeScriptupdated 2025-09-22aiai-agentsclaudeclaude-codecode
Completely free, private, UI based Tech Documentation MCP server. Designed for coders and software developers in mind. Easily integrate into Cursor, Windsurf, Cline, Roo Code, Claude Desktop App
★ 2,058TypeScriptupdated 2026-02-04clinecrawl4aicursordocumentationllm
TSGram - Telegram MCP Server for local Claude Code integration - debug and vibe code on the go!
★ 88JavaScriptupdated 2025-06-26
My personal Claude Code and OpenAI Codex setup with battle-tested skills, plugins, hooks and agents that I use daily.
★ 642Pythonupdated 2026-04-17ai-agentsai-toolsclaude-aiclaude-codeclaude-code-plugin
This MCP or multiple AI setup let claude code use Grok, Gemini and DeepSeek for reviewing and fixes
★ 142Pythonupdated 2025-09-03
An MCP Server for audio transcription using OpenAI
★ 52Pythonupdated 2025-10-16
★ 1JavaScriptupdated 2025-08-05
A Modern Admin Dashboard with Mantine7/React/NextJS14
★ 296TypeScriptupdated 2025-01-24admin-dashboardapp-routermantinemantine-v7nextjs
Dashboard sample using NextUI and NextJS
★ 261TypeScriptupdated 2023-09-06beautifuldashboardnextjsnextuireact
Modernize Next.js Free is a developer-friendly admin dashboard template built with Next.js, MUI, and Tailwind CSS. Designed for scalability, performance, and SEO, it helps developers create modern web apps faster with reusable components, clean architecture, and responsive UI for real projects.
★ 415TypeScriptupdated 2025-11-21free-materialfree-mui-nextjsfree-mui-templatefree-next-js-admin-templatefree-nextjs-admin-dashboard
Admin dashboard template.
★ 1,602TypeScriptupdated 2026-01-15nextjsreacttailwindcssvercel
Next.js admin dashboard template and UI components that come with pre-built elements, components, pages, high-quality design, integrations, and much more.
★ 479TypeScriptupdated 2026-03-16chartscomponentsdashboarddesign-systemgraph
An alignment auditing agent capable of quickly exploring alignment hypothesis
★ 998Pythonupdated 2026-04-25
Browser based tool to convert PDFs to Markdown
★ 335TypeScriptupdated 2025-12-25convertermarkdownnextjspdfrag
🥤 RAGLite is a Python toolkit for Retrieval-Augmented Generation (RAG) with DuckDB or PostgreSQL
★ 1,152Pythonupdated 2026-04-16chainlitcolbertduckdbevalslate-chunking
A cross-platform Markdown AI note-taking software.
★ 11,313TypeScriptupdated 2026-04-16agentchatbotknowledge-basellmmarkdown
`VectorMD` transforms markdown files into a semantically searchable database, leveraging vector embeddings to efficiently retrieve relevant code snippets or information based on query meanings.
★ 10Pythonupdated 2023-08-19
Nomic Developer API SDK
★ 1,877Pythonupdated 2025-11-11clusteringduplicate-detectionembeddingspythontext
Backend that powers the dataset viewer on Hugging Face dataset pages through a public API.
★ 857Pythonupdated 2026-04-17api-restdatadatasetshuggingfacemachine-learning
Simple go utility to download HuggingFace Models and Datasets
★ 966Goupdated 2026-04-11golanghuggingfacellmtransformers
A payments protocol for the internet. Built on HTTP.
★ 5,986TypeScriptupdated 2026-04-20
Automatic headphone equalization from frequency responses
★ 15,700Pythonupdated 2025-07-20
Terminal-based messaging client for Linux and macOS with Telegram, WhatsApp and Signal support
★ 1,709C++updated 2026-04-04consolelinuxmacosncursessignal-client
Feature rich WhatsApp Client for Desktop Linux
★ 3,147C++updated 2026-04-03linuxqt-whatsappwhatsappwhatsapp-chatwhatsapp-client
Mac app for crushing tech interviews with AI
★ 4,263Swiftupdated 2025-01-14aichatgptgptgpt-4openai
An Android keyboard that performs speech-to-text (STT/ASR) with OpenAI Whisper and input the recognized text; Supports English, Chinese, Japanese, etc. and even mixed languages.
★ 119Kotlinupdated 2025-12-21androidandroid-imeautomatic-speech-recognitionchinese-speech-recognitionime
On-device Speech Recognition for Android
★ 208Kotlinupdated 2026-01-24
Offline Speech Recognition with OpenAI Whisper and TensorFlow Lite for Android
★ 650C++updated 2026-03-18androidasrautomatic-speech-recognitionembeddedmobile
Privacy-first meeting transcription and voice-to-text tool for Linux. 100% local AI processing with faster-whisper and Ollama.
★ 13Shellupdated 2026-04-19
Speak to AI • Native Linux Speech-to-Text (STT) • Offline, Privacy-Focused
★ 97Goupdated 2026-04-19appimagedictationgolinuxvoice-input
A dictation application on linux using openai's whisper. Currently only used on KDE wayland.
★ 9Pythonupdated 2023-04-11
Speech-to-text typing for Linux/Wayland using Whisper.
★ 38Goupdated 2025-12-06
Gnome shell extension for accurate OFFLINE speech to text input in Linux using whisper.cpp. Input text from speech anywhere.
★ 105JavaScriptupdated 2025-04-09aiasrbloat-freedictatedictation
Offline voice input panel & keyboard with punctuation for Android.
★ 112Javaupdated 2024-06-01android-appofflinespeech-recognitionspeech-to-textwhisper-ai
Cross-Platform, GPU Accelerated Whisper 🏎️
★ 1,800TypeScriptupdated 2024-02-27audiomachine-learningrustspeech-recognitionwebgpu
Distilled variant of Whisper for speech recognition. 6x faster, 50% smaller, within 1% word error rate.
★ 4,073Pythonupdated 2025-01-08audiospeech-recognitionwhisper
Automatic Speech Recognition with Speaker Diarization based on OpenAI Whisper
★ 5,502Jupyter Notebookupdated 2026-02-23asrspeaker-diarizationspeechspeech-recognitionspeech-to-text
★ 12,575Jupyter Notebookupdated 2025-10-25
Turn any Excel spreadsheet into LLM consumable JSON
★ 12Pythonupdated 2026-02-28
A versatile and extensible platform for automation with hundreds of supported integrations
★ 312Pythonupdated 2026-04-15automationbluetoothdashboardhome-automationiot
Cog wrapper for ResembleAI/resemble-enhance
★ 11Pythonupdated 2025-01-19cog
This is a repository to be used when creating a repository template.
★ 379updated 2025-08-12
Music repair method to convert lossy MP3 compressed music to lossless music.
★ 368Pythonupdated 2025-08-12
Convert PDF to markdown + JSON quickly with high accuracy
★ 34,361Pythonupdated 2026-04-14
Open source, modular toolkit for AI-augmented marketing activities.
★ 2TypeScriptupdated 2025-10-22
JavaScript 3D Library.
★ 112,184JavaScriptupdated 2026-04-203daugmented-realitycanvashtml5javascript
★ 1,929Pythonupdated 2026-04-16
Arduino library to control external monitors over DDC/CI VCP by slightly abusing the VGA/DVI/HDMI port.
★ 53C++updated 2022-10-19
Web-based IP camera viewer for fast, simple streaming in any browser 🦇
★ 263Pythonupdated 2026-03-31
Kotlin DSL to generate XML based Watch Face Format for Wear OS : https://developer.android.com/training/wearables/wff/watch-face
★ 21Kotlinupdated 2024-04-27
The most intuitive desktop API client. Organize and execute REST, GraphQL, WebSockets, Server Sent Events, and gRPC 🦬
★ 18,495TypeScriptupdated 2026-04-16bruno-alternativegraphqlgrpchttphttp-client
Speech-to-text, text-to-speech, speaker diarization, speech enhancement, source separation, and VAD using next-gen Kaldi with onnxruntime without Internet connection. Support embedded systems, Android, iOS, HarmonyOS, Raspberry Pi, RISC-V, RK NPU, Axera NPU, Ascend NPU, x86_64 servers, websocket server/client, support 12 programming languages
★ 11,826C++updated 2026-04-20aarch64androidarm32asrcpp
Turn any PDF or image document into structured data for your AI. A powerful, lightweight OCR toolkit that bridges the gap between images/PDFs and LLMs. Supports 100+ languages.
★ 76,556Pythonupdated 2026-04-20ai4sciencechineseocrdocument-parsingdocument-translationkie
An Open Source implementation of Notebook LM with more flexibility and features
★ 22,710TypeScriptupdated 2026-04-19assistantlearningnote-takingnotebooknotes-app
Android app - Idea tracking for the creative ones
★ 40Javaupdated 2019-10-20androidideas
Use Claude Code CLI with any LLM provider - OpenAI, local models, or any OpenAI-compatible API
★ 21Pythonupdated 2025-09-06
GLM-4.5: Agentic, Reasoning, and Coding (ARC) Foundation Models
★ 4,329Pythonupdated 2026-02-01agentglmllmmoereasoning-language-models
A beautiful local-first coding agent running in your terminal - built by the community for the community ⚒
★ 1,767TypeScriptupdated 2026-04-20aiai-agentsai-codingcoding-agentsllm
A curated collection of awesome AI Agents and LLM Apps built with multiple tech stacks, showcasing real-world implementations using OpenAI, Gemini, local models, and various AI frameworks.
★ 758HTMLupdated 2026-02-10agentsaiappsautomationframework
AI agent, local alternative for Manus, specializing in marketing.
★ 122TypeScriptupdated 2025-06-16agentaiaiagentaitoolsmanus
Local coding agent with neat UI
★ 364JavaScriptupdated 2025-05-18aiai-agentsai-frameworkjavascriptlangchain
Shinkai is a two click install App that allows you to create Local AI agents in 5 minutes or less using a simple UI. Supports: MCPs, Remote and Local AI, Crypto and Payments.
★ 427TypeScriptupdated 2026-02-03ai-agentscrypto-ai-agentsdecentralized-ailocal-ailocal-ai-agents
open-source, local-first AI CLI for developers. It connects to your local Ollama models or remote providers like OpenAI, Anthropic, Gemini, and Hugging Face, letting you chat with your code, review changes, and craft commits — all from the terminal.
★ 56TypeScriptupdated 2026-01-11aiclaude-codeclicodexdeveloper
Local AI CLI alternative to Gemini CLI/Claude Code - works with LM Studio and local models
★ 9TypeScriptupdated 2025-06-28
CLI tool for managing Claude Code agents in local projects"
★ 20Rustupdated 2025-08-26agentsaiclaudeclaude-code
Python command-line tool for interacting with AI models through the OpenRouter API/Cloudflare AI Gateway, or local self-hosted Ollama. Optionally support Microsoft LLMLingua prompt token compression
★ 21updated 2025-12-28ai-ragcloudflare-aicloudflare-ai-gatewaylinkupllm-inference
Declaratively define and run required tools across environments, from local development to containerized cloud deployments.
★ 149Goupdated 2026-04-07aiclidaemondeclarativemcp
Command line artificial intelligence - Your local LLM context-feeder
★ 142Goupdated 2026-04-20aiclicontext-feedergogolang-tools
One command brings a complete pre-wired LLM stack with hundreds of services to explore.
★ 2,871TypeScriptupdated 2026-04-16aiautomationbashclicontainer
A text-based user interface (TUI) client for interacting with MCP servers using Ollama. Features include agent mode, multi-server, model switching, streaming responses, tool management, human-in-the-loop, thinking mode, model params config, MCP prompts, custom system prompt and saved preferences. Built for developers working with local LLMs.
★ 665Pythonupdated 2026-04-15agentic-aiaicommand-line-toolgenerative-ailinux
Autonomous CLI Agent that uses Local LLM with Ollama to execute tasks in CLI.
★ 8Pythonupdated 2024-09-12autonomous-agentsgptlarge-language-modelsllmollama
A suite of local AI-powered command-line tools
★ 188Pythonupdated 2026-04-14
:triangular_ruler: A typesetting library for SVG and Canvas
★ 149TypeScriptupdated 2025-09-08canvasocto-correct-managedsvgtexttypesetting
A W.I.P desktop application for a new typesetting language, typst.
★ 728Rustupdated 2025-04-11desktopguihacktoberfestlatexrust
⚒ Supercharge command-line publication workflow.
★ 213TypeScriptupdated 2026-04-20headless-chromejavascriptpdfvitevivliostyle
📖 The power of CSS typesetting, right at your fingertips.
★ 745TypeScriptupdated 2026-04-20cssepubtypesettingvivliostyle
Typst MCP Server is an MCP (Model Context Protocol) implementation that helps AI models interact with Typst, a markup-based typesetting system. The server provides tools for converting between LaTeX and Typst, validating Typst syntax, and generating images from Typst code.
★ 144Pythonupdated 2026-04-18llmmcppandoctypst
A no-frills curriculum vitae (CV) template using Typst and YAML to version control CV data.
★ 503Typstupdated 2024-12-31cvcv-templatepdfresumeresume-template
A colorful resume template for Typst
★ 107Typstupdated 2025-04-08cvcv-templateresumeresume-templatetemplate
A modern typst resume template
★ 67Typstupdated 2025-11-22cvcv-templateresumetypsttypst-template
Resume builder for academics and engineers
★ 16,425Pythonupdated 2026-04-06cvcv-buildercv-generatorcv-templatepython
A modern resume template written in Typst, inspired by Awesome-CV
★ 560Typstupdated 2026-04-15awesome-cvcleancover-lettercover-letter-templatecover-letter-templates
💼 another CV template for your job application, yet powered by Typst and more
★ 770Typstupdated 2026-03-22cvpdfprompt-injectionresumeresume-template
free online AI resume editor,the only official website is https://magicv.art
★ 6,761TypeScriptupdated 2026-04-19aideepseekdoubaomotionreact
💼 🎨 A modern software developer resume built with React and JSONResume
★ 2,149JavaScriptupdated 2026-02-25github-pageshobbiesreactresumeresume-template
JSON-Schema is used here to define and validate our proposed resume json
★ 2,372JavaScriptupdated 2026-01-21
CLI tool to easily setup a new resume 📑
★ 4,710JavaScriptupdated 2024-04-03clijavascriptjsonresume
Generate polished résumés and CVs in HTML, Markdown, LaTeX, MS Word, PDF, plain text, JSON, XML, YAML, smoke signal, and carrier pigeon.
★ 9,347JavaScriptupdated 2022-04-03
Resume,Resume Templates,程序员简历例句,简历模版,
★ 7,241updated 2025-09-23resumeresume-templateresume-website
The Markdown Resume
★ 1,742TeXupdated 2024-02-28
:necktie: :briefcase: Build fast :rocket: and easy multiple beautiful resumes and create your best CV ever! Made with Vue and LESS.
★ 16,461Vueupdated 2024-06-11cvjavascriptnodejspdfresume
OpenResume is a powerful open-source resume builder and resume parser. https://open-resume.com/
★ 8,570TypeScriptupdated 2024-10-29nextjsreactresumeresume-builderresume-parser
A one-of-a-kind resume builder that keeps your privacy in mind. Completely secure, customizable, portable, open-source and free forever. Try it out today!
★ 36,457TypeScriptupdated 2026-04-14better-authhacktoberfestreactresumeresume-builder
A markup-based typesetting system that is powerful and easy to learn.
★ 53,054Rustupdated 2026-04-20compilermarkuptypesettingtypst
Containers for machine learning
★ 9,402Goupdated 2026-04-17aicontainerscudadockermachine-learning
Real-ESRGAN aims at developing Practical Algorithms for General Image/Video Restoration.
★ 35,193Pythonupdated 2024-08-06aminedenoiseesrganimage-restorationjpeg-compression
GGUF Quantization support for native ComfyUI models
★ 3,545Pythonupdated 2026-01-12
Dandere2x - Fast Waifu2x Video Upscaling.
★ 1,507C++updated 2023-08-17compressionfastfastervideowaifu2x
Enhance Images with Javascript and AI. Increase resolution, retouch, denoise, and more. Open Source, Browser & Node Compatible, MIT License.
★ 885TypeScriptupdated 2026-04-17aideblurringdehazingdenoisingderaining
Rembg is a tool to remove images background
★ 22,701Pythonupdated 2026-04-08background-removalimage-processingpython
Remove background from any image
★ 236Pythonupdated 2025-03-03
Digital Human Resource: 2D/3D/4D Human Modeling, Avatar Generation & Animation, Clothed People Digitalization, Virtual Try-On, etc.
★ 1,936updated 2026-04-18avatarclothed-people-digitalizationdigital-humanvirtual-try-on
★ 437Pythonupdated 2024-12-11
TripoSR: Fast 3D Object Reconstruction from a Single Image
★ 6,404Pythonupdated 2024-08-16
The Alibaba Cloud V1.0 SDK will soon enter the Basic Security Maintenance phase and is no longer recommended for use. V2.0 SDK is available here: https://github.com/aliyun/alibabacloud-python-sdk
★ 1,046Pythonupdated 2026-04-02pythonsdkv1
MCP server connecting Claude to Vercel
★ 67TypeScriptupdated 2025-08-05
SVAR - Simple Voice Activated Recorder
★ 63Cupdated 2025-12-01alsaaudio-recordermp3ogg-opusogg-vorbis
Cross-platform audio recorder designed for real-time speech audio processing
★ 129Cupdated 2026-04-18audiocdotnetgolangnodejs
An audio recording helper for React. Provides a component and a hook to help with audio recording.
★ 260TypeScriptupdated 2024-06-02audioaudio-recorderaudio-recordingdownloadnextjs
Open AI Video Subtitle Generator Agent Generate .srt subtitle files for any video no length limit, 100% free, offline, and runs locally on your machine.
★ 17Pythonupdated 2025-10-20editinggui-applicationpython3subtitlessubtitles-generator
App for transcribing audio/video to editable SRT subtitles using Whisper. Supports mp3/mp4/wav inputs, audio extraction, and local download.
★ 1Pythonupdated 2025-05-26openai-apistreamlit
An offline-first desktop app to automatically transcribe and edit video subtitles using OpenAI Whisper. Full control over text, timing, and advanced styling in a powerful, intuitive editor.
★ 4Pythonupdated 2025-08-16
Transcribe Offline by openresearchtools.com is an open source desktop application that allows you to transcribe audio and video fully offline, with optional speaker diarisation and word-level alignment. It can also generate subtitles and integrate with local large language models (LLMs) for summarisation and editing
★ 9Rustupdated 2026-03-21ailocalaimacosopen-sourcetranscribe
An audio/video transcriber with diarization and transcription editing.
★ 10JavaScriptupdated 2026-03-17
A lightweight transcript editor for editing and correcting STT generated timed transcripts
★ 57JavaScriptupdated 2026-01-03
A React component to make correcting automated transcriptions of audio and video easier and faster. By BBC News Labs. - Work in progress
★ 614JavaScriptupdated 2024-02-12bbc-news-labskaldinews-labsreactstt
The website of the Public AI Inference Utility
★ 13TypeScriptupdated 2026-04-12
A curated list of amazing Runpod projects, libraries, and resources
★ 128updated 2026-04-04
RunPod Serverless worker for WhisperX
★ 19Pythonupdated 2026-03-26
Tero Subtitler is an open source, cross-platform, and free subtitle editing software.
★ 443Pascalupdated 2026-04-18aiaudio-to-textblu-raycaptionseditor
a comfyui cuatom node for audio subtitling based on whisperX and translators
★ 62Pythonupdated 2025-04-01srt-subtitlessutitlestranslationwhisper
Free on-device web app for audio transcribing and rendering subtitles
★ 363ReScriptupdated 2026-02-01airescriptsubtitleswebcodecswhisper
Generate transcripts for audio and video content with a user friendly UI, powered by Open AI's Whisper with automatic translations and download videos automatically with yt-dlp integration
★ 809JavaScriptupdated 2023-03-16expressjsgpulibretranslatemachine-learningnodejs
Convert subtitles from one format to another format. Supported formats: STL EBU, TTML SMI, VTT, SRT
★ 109Javaupdated 2025-07-12video
Automatically generate and overlay subtitles for any video.
★ 2,203Pythonupdated 2024-07-12ffmpegopenai-whispersubtitle-generatorsubtitlessubtitles-generator
Cross-platform advanced subtitle editor
★ 1,711C++updated 2026-04-06
the subtitle editor :)
★ 12,708C#updated 2026-04-20
Neural building blocks for speaker diarization: speech activity detection, speaker change detection, overlapped speech detection, speaker embedding
★ 9,830Jupyter Notebookupdated 2026-04-16overlapped-speech-detectionpretrained-modelspytorchspeaker-change-detectionspeaker-diarization
WhisperSubs is a mpv lua script to generate subtitles at runtime with whisper.cpp on Linux
★ 99Luaupdated 2025-02-09
A Python tool that uses Google Gemini API to transcribe video or audio files into SRT subtitle files.
★ 19Pythonupdated 2026-01-02asrgeminigemini-apitranscribe
The Multi-Language Automatic Translation, Subtitling, and Voice Rendering System uses third party software to automatically convert audio to text, translate text, render text to video, and render text to audio.
★ 29PHPupdated 2024-07-29audiolanguagephpspeechsrt
PySimpleGUI based DESKTOP APP to AUTO GENERATE SUBTITLE FILE (using free Google Speech Recognition API) and TRANSLATED SUBTITLE FILE (using unofficial online Google Translate API) for any video or audio file
★ 189Pythonupdated 2024-05-05auto-captionauto-subtitlecaptionsffmpeggoogle-translate
Automatically generate subtitles from an input audio or video file using OpenAI Whisper
★ 53TypeScriptupdated 2026-03-17ffmpegopenaiopenai-whispersubtitle-generatorsubtitles
Transcribe audio and add subtitles to videos using Whisper in ComfyUI
★ 229Pythonupdated 2026-01-02comfyuistable-diffusionwhisper-ai
Transcribe any audio to text, translate and edit subtitles 100% locally with a web UI. Powered by whisper models!
★ 2,979Svelteupdated 2025-08-15aiaudio-to-textgolangspeech-recognitionspeech-to-text
Convert audio files (flac, mp3, mp4, mpeg, mpga, m4a, ogg, wav, and webm) to SRT subtitles with OpenAI Whisper. Easy script for fast, accurate transcription.
★ 9Pythonupdated 2024-06-11
HyperMotion is a pose guided human image animation framework based on a large-scale video diffusion Transformer.
★ 140Pythonupdated 2026-03-10dithuman-video-animationhuman-video-generationmotion-generationpose-guided-text-to-image-generation
[EMNLP 2024 & AAAI 2026] A powerful toolkit for compressing large models including LLMs, VLMs, and video generative models.
★ 711Pythonupdated 2026-04-01awqbenchmarkdeepseek-v3deploymentevaluation
[CVPR 2026 Highlight] High-Quality Text-to-Video Generation with Alpha Channel
★ 360Pythonupdated 2026-04-09
Start and end frames video generation nodes based on the modified Kijai version Wan2.1 nodes
★ 383Pythonupdated 2025-03-22
★ 6,340Pythonupdated 2026-02-22
This project is a digital human that can talk and listen to you. It uses OpenAI's GPT to generate responses, OpenAI's Whisper to transcript the audio, Eleven Labs to generate voice and Rhubarb Lip Sync to generate the lip sync.
★ 430JavaScriptupdated 2026-01-18ai-avatarsdigital-humanelevenlabslip-synclipsync
We present StableAvatar, the first end-to-end video diffusion transformer, which synthesizes infinite-length high-quality audio-driven avatar videos without any post-processing, conditioned on a reference image and audio.
★ 1,232Pythonupdated 2026-01-20aigcavatar-generatorvideo-generation
Automatically create subtitles for any video using google speech to text cloud api.
★ 22Pythonupdated 2018-08-23
Create subtitles in various languages in mere minutes using Whisper and Qwen3-32b via Groq's lightning-fast inference.
★ 94Pythonupdated 2025-12-17managed-by-terraform
A node module to generate subtitles by segmenting a list of time-coded text - BBC News Labs
★ 53JavaScriptupdated 2023-07-08captionsdigital-paper-editittjsonnews-labs
This project is a video processing application that extracts audio from videos, performs automatic speech recognition (ASR), and generates subtitles. It allows users to enhance audio quality, correct transcription errors, and convert subtitles into various dialects, all through a user-friendly command-line and web interface.
★ 50Pythonupdated 2025-03-30
🎬 Auto-subtitle videos with AI transcription, translation, voice cloning, professional rendering, background image and music generator
★ 215JavaScriptupdated 2026-03-13
Examples of programs built using Modal
★ 1,172Pythonupdated 2026-04-20clouddistributedgpumachine-learningmodal
GPU documentation for humans
★ 568Pythonupdated 2026-03-24documentationgpu
SDK libraries for Modal
★ 466Pythonupdated 2026-04-20aiclouddata-sciencedistributedgenai
Deep neural network (DNN) for noise reduction, removal of background music, and speech separation
★ 172Pythonupdated 2022-11-21noise-reductionspeech-separation
Cloudinary Asset Management API
★ 7TypeScriptupdated 2026-04-20
Daminik is a simple & scalable Digital Asset Manager with a built-in Content Delivery Network. The single source of truth for all your assets.
★ 291PHPupdated 2026-02-13cdndamdigital-asset-managementimage-editorphp
A self-hosted digital asset manager for 3d print files.
★ 1,912Rubyupdated 2026-04-203d-printingdamdigital-asset-managementhacktoberfestobj-files
423 plugins, 2,849 skills, 177 agents for Claude Code. Open-source marketplace at tonsofskills.com with the ccpi CLI package manager.
★ 2,032Pythonupdated 2026-04-19agent-skillsaiai-agentsanthropicautomation
Discover, share, and manage Claude Code slash commands. Like npm for JavaScript, but for Claude Code slash commands.
★ 6TypeScriptupdated 2025-07-18
Professional workflow system for Claude Code with universal slash commands and integrated task management
★ 15JavaScriptupdated 2025-09-07
claco is a CLI tool for boosting Claude Code productivity - manage hooks, slash commands, and inspect session history
★ 33Rustupdated 2026-02-11claude-code
Claude code slash commands creation for session management
★ 14Shellupdated 2025-09-13
Collection of custom slash commands for Claude Code
★ 12Shellupdated 2025-06-15
interactive terminal interface for discovering, previewing, and managing Claude Code configuration files and slash commands.
★ 270TypeScriptupdated 2026-04-17claudeclaude-code
★ 1TypeScriptupdated 2026-03-11
AssetsUp is a modern inventory and asset management system designed to help businesses track, register, monitor, and manage physical and digital assets across departments, branches, and even countries.
★ 12Rustupdated 2026-03-30nestjsnextjsstellartypescript
This is the source code for the famous open source digital asset management - Razuna
★ 176ColdFusionupdated 2026-04-09
Core Framework for the Open Core Data & Experience Management Platform (PIM, MDM, CDP, DAM, DXP/CMS & Digital Commerce)
★ 3,748PHPupdated 2026-04-20cdpcmscms-frameworkcustomer-data-platformdam
Docker image for ResourceSpace
★ 35Dockerfileupdated 2025-10-10
Self-hosted MCP Gateway for Individuals & Teams
★ 980Goupdated 2026-04-20ai-agentsinfrastructuremcpmcp-gatewaymcp-registry
A collection of recipes showcasing fun and effective ways of using smithery
★ 16TypeScriptupdated 2025-09-23
Official MCP server for Smithery CLI
★ 6TypeScriptupdated 2025-04-13
A curated list of awesome resources for building immersive CLI experiences.
★ 346updated 2026-01-24awesomeawesome-listclicommand-linecommand-line-tool
The largest Awesome Curated list of command line programs (CLI/TUI) with source data organized into CSV files
★ 2,470Pythonupdated 2026-03-16awesomeawesome-listclicli-appscommand-line
🖥 📊 🕹 🛠 A curated list of command line apps
★ 19,410Shellupdated 2026-04-13awesomeawesome-listclicli-applist
Attio Model Context Protocol (MCP) server implementation
★ 67TypeScriptupdated 2026-04-16
★ 15JavaScriptupdated 2025-03-07
Media sorting tool to organize photos and videos from your camera in folders by year, month and day.
★ 995Pythonupdated 2024-05-06cameraexiftoolorganize-media-filesorganize-photosphotobackup
A desktop image gallery with a privacy-first approach. It detects objects and clusters faces.
★ 232Pythonupdated 2026-02-27gsocgsoc-2024gsoc-2025hacktoberfest
digiKam is an advanced open-source digital photo management application that runs on Linux, Windows, and MacOS. The application provides a comprehensive set of tools for importing, managing, editing, and sharing photos and raw files.
★ 750C++updated 2019-12-21
QualityScaler - image/video AI upscaler app
★ 3,036Pythonupdated 2026-04-05amdanimecompression-artifact-reductiondeep-learningdirectx-12
A machine learning-based video super resolution and frame interpolation framework. Est. Hack the Valley II, 2018.
★ 19,670C++updated 2026-03-07anime4kframe-interpolationmachine-learningneural-networksrealcugan
All Algorithms implemented in Python
★ 220,202Pythonupdated 2026-04-13algorithmalgorithm-competitionsalgorithms-implementedalgoscommunity-driven
The largest collection of PyTorch image encoders / backbones. Including train, eval, inference, export scripts, and pretrained weights -- ResNet, ResNeXT, EfficientNet, NFNet, Vision Transformer (ViT), MobileNetV4, MobileNet-V3 & V2, RegNet, DPN, CSPNet, Swin Transformer, MaxViT, CoAtNet, ConvNeXt, and more
★ 36,710Pythonupdated 2026-04-17augmixconvnextdistributed-trainingefficientnetimage-classification
PyTorch docker images for use in GPU cloud and local environments. Includes AI-Dock base for authentication and improved user experience.
★ 14Shellupdated 2024-06-14aicudadockerjupytermachine-learning
ComfyUI with AMD ROCm support for GPU-accelerated AI image generation on AMD RX 6000/7000+ GPUs
★ 42Pythonupdated 2025-07-20
ComfyUI nodes for WanAnimate model input preprocessing
★ 505Pythonupdated 2025-12-22
HunyuanVideo-I2V: A Customizable Image-to-Video Model based on HunyuanVideo
★ 1,810Pythonupdated 2026-04-07diffusion-modelsimage-to-videoimage-to-video-generationvideogeneration
Animate Anyone: Consistent and Controllable Image-to-Video Synthesis for Character Animation
★ 14,782updated 2025-09-20
Upscale your videos up to 4k on free google colab using Real-ESRGAN
★ 207Jupyter Notebookupdated 2025-05-014krealesrganstable-diffusionsuper-resolutionupscaler
Source code for free AI video upscaler tool
★ 408TypeScriptupdated 2026-02-10upscalingvideo-enhancementwebcodecswebglwebgpu
Video, Image and GIF upscale/enlarge(Super-Resolution) and Video frame interpolation. Achieved with Waifu2x, Real-ESRGAN, Real-CUGAN, RTX Video Super Resolution VSR, SRMD, RealSR, Anime4K, RIFE, IFRNet, CAIN, DAIN, and ACNet.
★ 16,459C++updated 2026-04-19animeanime4kesrganframe-interpolationimage-enlarger
A consolidation of various compiled open-source AI image/video upscaling product for a working CLI friendly image and video upscaling program.
★ 481Shellupdated 2025-05-08amd64amd64onlybsd-3-clauseclidebian
Interpolate, Upscale, Decompress, and Denoise videos easily on Linux/Windows/MacOS.
★ 1,911Pythonupdated 2026-04-19guiinterpolationlinuxmacosreal-esrgan
Official SeedVR2 Video Upscaler for ComfyUI
★ 2,380Pythonupdated 2025-12-24aicomfyuicomfyui-nodesupscalervideo-processing
[CVPR 2024] Upscale-A-Video: Temporal-Consistent Diffusion Model for Real-World Video Super-Resolution
★ 1,457Pythonupdated 2024-09-27aigc-enhancementdeflickervideo-diffusion-modelvideo-super-resolution
🕶 A curated list of Tiny Object Detection papers and related resources.
★ 1,622updated 2023-10-04awesome-listface-detectionobject-detectionpedestrian-detectionsmall-object-detection
Papers, code and datasets about deep learning for 3D Object Detection.
★ 686updated 2025-09-173d-representationautonomous-drivingcomputer-visioncvprcvpr2020
3D object detection
★ 203updated 2023-05-30
This is a list of awesome articles about object detection from video.
★ 247updated 2019-07-01awesome-listcomputer-visiondeep-learningdeep-neural-networksobject-detection
🚀🚀🚀 A collection of some awesome public YOLO object detection series projects and the related object detection datasets.
★ 1,728updated 2025-05-31cudadatasetsdeepseekfew-shot-object-detectiongui
End-to-End Object Detection with Transformers
★ 15,237Pythonupdated 2024-03-12
Running object detection on a webcam feed using TensorRT on NVIDIA GPUs in Python.
★ 229Pythonupdated 2021-02-09
Object Detection toolkit based on PaddlePaddle. It supports object detection, instance segmentation, multiple object tracking and real-time multi-person keypoint detection.
★ 14,181Pythonupdated 2026-03-19blazefacedeepsortdetrface-detectionfairmot
Zero-Shot Speech Editing and Text-to-Speech in the Wild
★ 8,476Jupyter Notebookupdated 2025-03-15
A Python/Pytorch app for easily synthesising human voices
★ 1,440Pythonupdated 2024-12-02deep-learningpythonpytorchtacotron2text-to-speech
★ 94Teaupdated 2026-04-20alibabaalibaba-cloudaliyundarabonbadsl
Automate Creation of Story-Based Videos.
★ 173Goupdated 2024-09-22dockergenerative-aigolangllmollama
An AI-powered storytelling video generator that takes user input as a story prompt, generates a story using OpenAI's GPT-3, creates images using OpenAI's DALL-E, adds voiceover using ElevenLabs API, and combines the elements into a video.
★ 216Pythonupdated 2024-09-17aiartificial-intelligencedall-eediting-videosopenai
AI-powered podcast & video generator.
★ 451TypeScriptupdated 2026-04-20
Animation engine for explanatory math videos
★ 86,302Pythonupdated 2026-04-183b1b-videosanimationexplanatory-math-videospython
LTX-Video Support for ComfyUI
★ 3,517Pythonupdated 2026-04-13comfyuidiffusion-modelsditimage-to-videoimage-to-video-generation
ComfyUI's ControlNet Auxiliary Preprocessors
★ 3,946Pythonupdated 2026-04-13
ComfyUI docker images for use in GPU cloud and local environments. Includes AI-Dock base for authentication and improved user experience.
★ 1,030Shellupdated 2024-11-04aicomfyuidockerimage-processingrunpod
Examples of ComfyUI workflows
★ 4,141HTMLupdated 2025-11-26
ComfyUI-Manager is an extension designed to enhance the usability of ComfyUI. It offers management functions to install, remove, disable, and enable various custom nodes of ComfyUI. Furthermore, this extension provides a hub feature and convenience functions to access a wide range of information within ComfyUI.
★ 14,387Pythonupdated 2026-04-19
LDSR custom node for ComfyUI
★ 269Pythonupdated 2024-06-14
Wan: Open and Advanced Large-Scale Video Generative Models
★ 15,911Pythonupdated 2026-03-05aigcvideogeneration
claude code has a rate limit. auto queue instructions when rate limit resets.
★ 39Pythonupdated 2026-03-22
harness-engineering discussion of shortcuts, automation, hacks and overall productivity with code agents like claude code, codex, and other harness.
★ 90Shellupdated 2026-03-17
Customize Claude Code's system prompts, create custom toolsets, input pattern highlighters, themes/thinking verbs/spinners, customize input box & user message styling, support AGENTS.md, unlock private/unreleased features, and much more. Supports both native/npm installs on all platforms.
★ 1,878TypeScriptupdated 2026-04-17agenticanthropicbunclaude-codeclaude-code-native
The coding agent for professionals
★ 108TypeScriptupdated 2025-08-18aianthropicclaudellmmcp
VS Code helper extension to paste clipboard images in VS Code terminal in WSL
★ 12JavaScriptupdated 2025-06-10
AI-powered Kanban board with Claude Code automation. Tasks, real-time execution, feedback loops.
★ 49TypeScriptupdated 2025-12-22ai-automationanthropicclaude-aiclaude-codefeedback-system
Expose VSCode features such as file viewing and editing as MCP, enabling advanced AI-assisted coding directly from tools like Claude Desktop
★ 114TypeScriptupdated 2025-10-18
[GenAI Application Development Framework] 🚀 Build GenAI application quick and easy 💬 Easy to interact with GenAI agent in code using structure data and chained-calls syntax 🧩 Use Event-Driven Flow *TriggerFlow* to manage complex GenAI working logic 🔀 Switch to any model without rewrite application code
★ 1,550Pythonupdated 2026-04-16agentagent-based-frameworkagent-frameworkchatglmclaude
This is an MCP server that emulates Claude Code's task management system, providing persistent todo functionality for AI coding assistants in IDEs like Cursor, Windsurf, and others.
★ 25Pythonupdated 2025-11-21
Specs, tracking, and coordinated development for AI coding. Works with Cursor, Claude Code, Replit Agent, and any AI coding assistant.
★ 68updated 2025-08-16
Automatically generate high-quality markdown context files for AI coding agents like Claude, Cursor, and Gemini, Powered By DeepWiki
★ 116TypeScriptupdated 2026-03-23claude-codecursorllm
AI engineering team in your terminal | Builds production software, not prototypes.
★ 65TypeScriptupdated 2026-04-01claudecodesajicode
AI-powered file organization and context engineering that understands content, not patterns. Automatically sorts temporary scripts from permanent docs while preserving your workflow. Works seamlessly with Claude Code hooks. Protects README, LICENSE, configs.
★ 61TypeScriptupdated 2025-08-18claude-aiclaude-codecontext-engineering
Install our local first extensions for your favorite AI IDE or Terminal Agent. Sync your conversations to the cloud. File issues and requests.
★ 1,185Goupdated 2026-04-09aichat-historyclaudeclaude-codecodex
Turn Claude Code into a coordinated team of 40+ specialized AI agents that work together like a world-class engineering organization.
★ 61updated 2026-03-18agentagentsaiai-agentsanthropic
Code search MCP for Claude Code. Make entire codebase the context for any coding agent. Embeddings are created and stored locally. No API cost.
★ 219Pythonupdated 2025-11-13agentai-codingclaudeclaude-codecode-generation
Turn approved specs into long-running autonomous implementation. A minimal, adaptable SDD harness with Agent Skills for Claude Code, Codex, Cursor, Copilot, Windsurf, OpenCode, Gemini CLI, and Antigravity.
★ 3,200TypeScriptupdated 2026-04-14agent-skillsclaude-codecodexcursorgemini-cli
A YAML-based Playwright MCP automation testing framework designed for Claude Code
★ 176JavaScriptupdated 2025-07-19claudecodeplaywright
Vercel AI SDK community provider for Claude Agent SDK
★ 341TypeScriptupdated 2026-03-10aiai-sdkclaude-codeclaude-code-sdk
kiro to claude code
★ 356Goupdated 2025-08-20apiclaudecode
Open-source platform for AI-driven storytelling, worldbuilding, and immersive roleplay
★ 808TypeScriptupdated 2026-03-30
Make your own story. User-friendly software for LLM roleplaying
★ 1,420TypeScriptupdated 2026-04-18aicharacterschatchatbotclaude
End-to-end workflow to automatically generate show notes from audio/video transcripts
★ 94TypeScriptupdated 2026-02-25assembly-aichatgptclaudedeepgramgemini
Multi-Agent Blog Generator based on Agno framework. Supports leading LLM providers like OpenAI, Gemini, Claude, and Grok.
★ 74Pythonupdated 2026-01-06agentic-aiagentsagnoai-agentsclaude
A methodology for effective single-agent development in Claude Code, following Cognition.ai's "Don't Build Multi-Agents" research.
★ 4updated 2025-07-14
24/7 AI Research Agent using Claude Code SDK - Monitors arXiv and generates intelligent research digests
★ 8Pythonupdated 2026-02-15aiautomationresearch
🔌 Claude Code Plugin for institutional-grade equity research. Install with /plugin marketplace add. Generates professional buy/sell recommendations with comprehensive fundamental analysis, technical indicators, and risk assessment. Educational use only - not financial advice.
★ 454updated 2026-03-15ai-poweredclaude-codeclaude-code-pluginequity-researchfinance
A study assistant powered by Claude Opus. It provides various tools to assist with different tasks, such as researching,coding,note-taking and more.
★ 26Pythonupdated 2024-07-18aillmpythonrag
Universal AI CLI & Python SDK for 8+ providers (OpenAI, Claude, Gemini, Cohere, Perplexity, IBM watsonx, Groq, Together AI). Multi-provider chat, code generation, cost optimization, age-appropriate AI. Claude Code/Gemini CLI alternative with zero vendor lock-in.
★ 30Pythonupdated 2026-02-21
AgentNetworkProtocol(ANP) is an open source protocol for agent communication. Our vision is to define how agents connect with each other, building an open, secure, and efficient collaboration network for billions of intelligent agents.
★ 1,276HTMLupdated 2026-04-15agentcommunicationprotocol
Enable AI models for video production in the browser
★ 2,345TypeScriptupdated 2025-06-12aimediavideo
A free, open source, and extensible speech-to-text application that works completely offline.
★ 20,572Rustupdated 2026-04-19accessibilitycross-platformspeech-to-texttauri-v2
280+ free n8n automation templates — ready-to-use workflows for Gmail, Telegram, Slack, Discord, WhatsApp, Google Drive, Notion, OpenAI, and more. AI agents, RAG chatbots, email automation, social media, DevOps, and document processing. The largest open-source n8n template collection.
★ 21,599updated 2026-04-09ai-agentsai-automationautomationautomation-templatesawesome
A Lightweight LLM Post-Training Library
★ 2,242Pythonupdated 2026-04-19
Anthropic's Interactive Prompt Engineering Tutorial
★ 34,999Jupyter Notebookupdated 2026-03-01
Anthropic's educational courses
★ 20,862Jupyter Notebookupdated 2025-11-13
A collection of notebooks/recipes showcasing some fun and effective ways of using Claude.
★ 41,562Jupyter Notebookupdated 2026-04-17
Access to Anthropic's safety-first language model APIs in TypeScript
★ 1,890TypeScriptupdated 2026-04-20
★ 6,539Pythonupdated 2026-04-20
Official repository for LTX-Video
★ 10,102Pythonupdated 2026-01-05diffusion-modelsditimage-to-videoimage-to-video-generationtext-to-video
Blazor Component Library based on Material Design principles. Do more with Blazor, utilizing CSS and keeping JavaScript to a bare minimum.
★ 10,351C#updated 2026-04-20blazorblazor-componentscomponentcomponent-librarycomponents
Voice notifications for multi-terminal Claude Code users
★ 8Pythonupdated 2026-01-09
🔊 Intelligent voice notifications for Claude Code using ElevenLabs TTS
★ 12Shellupdated 2025-08-12
Add voice-to-text capabilities to Claude Code using OpenAI Whisper for speech recognition.
★ 8Pythonupdated 2025-08-09
> Transform Claude Code CLI into your AI development companion with voice control, background processing, and intelligent automation.
★ 14JavaScriptupdated 2025-09-11aiautomationclaudeclideveloper-tools
Connect AI models like Claude & GPT with robots using MCP and ROS.
★ 1,186Pythonupdated 2026-04-20mcpmcp-servermodelcontextprotocolrosros-mcp-server
A tool that monitors terminal windows and automatically responds to Claude Code confirmation prompts
★ 53Pythonupdated 2025-06-05
🚀 Claude Code API | CLI to API Platform | Transform Claude CLI, Gemini CLI, Cursor CLI into REST APIs | One-Click Deploy | Web Terminal
★ 23HTMLupdated 2025-10-29aiai-poweredapi-generatorautomationclaude-ai
Terminal-based AI Coding Agent, similar to Claude Code, OpenAI Codex etc. but works with many more LLMs e.g. Gemini, Groq, Deepseek
★ 153Pythonupdated 2025-05-02
Unopinionated AI for the Shell. A lightweight AI CLI for scripts, pipelines, and automation, with a universal client for MCP, A2A, and other AI protocols. .
★ 159TypeScriptupdated 2026-02-18
Mark web pages for use with vision-language models
★ 59TypeScriptupdated 2026-03-08claudecomputer-usecomputer-using-agentcuagemini
Novel-OS is a structured workflow system that gives AI the context it needs to help you write compelling fiction—consistently and efficiently. It provides three layers of context (Standards, Novel, and Manuscripts) to ensure AI writes prose that sounds like YOU. Works with Claude Code, Cursor, and any AI tool. Supports any genre or length.
★ 36Shellupdated 2025-08-18ai-writingai-writing-assistantauthor-toolsclaude-aiclaude-code
🐲 Ultra-fast Claude Code Max usage dashboard with real-time analytics, multi-language support, and dragon-inspired design. Built with Electron + React + TypeScript for cross-platform desktop experience.
★ 13JavaScriptupdated 2026-01-08
Rules and instructions for agentic coding tools like Cursor, Claude CLI, Gemini CLI, Qodo, Cline and more
★ 52TypeScriptupdated 2026-04-10agentic-aiagentic-workflowai-agentsclaude-codecopilot
Skill management tool for AI agents - discover and install pre-built workflows from Anthropic, OpenAI, and community sources
★ 12Rustupdated 2026-03-27aiclaudeclicodexrust
Professional AI assistant configurations for Claude Code, Codex CLI, OpenCode and Gemini CLI with enterprise-grade defaults for Solidity and TypeScript development.
★ 54Shellupdated 2025-12-15claude-codecodexcursor
Elevate vibe coding to vibe engineering: Get consistent Github Copilot custom instructions, Cursor, Roo Code, Cline, Windsurf, Claude Code, Gemini Cli, Codex CLI, kilo code, warp custom rules via a universal, managed template. Features vibe coding memory bank & best practices for large codebases.
★ 594Pythonupdated 2025-10-03claude-codeclinecodex-clicontext-encursor
Huge AI models catalog. A curated list of AI tools, platforms, and resources across various domains.
★ 479Shellupdated 2026-03-18agentsaiartificial-intelligenceartificial-intelligence-algorithmsawesome
🔥 Visual AI research assistant that displays real-time thinking, provides split-view analysis, and automatic citations using Claude and Firecrawl
★ 634TypeScriptupdated 2025-07-02
🤖 A CLI tool that transforms web content into polished blog posts using AI. Scrape websites, pull Reddit discussions, and let OpenAI/Claude craft engaging articles - all from your terminal. Features a sleek TUI interface and smart image handling with AI-generated alt text.
★ 11Pythonupdated 2024-11-14aibloggingpython
Use Claude Code CLI to write full novels
★ 39Shellupdated 2025-08-16
📧 Never miss important Claude Code events again! Get instant email notifications when Claude needs your input, finishes tasks, or runs into issues. Features smart templates, automatic Claude Code integration, and support for Chinese (Simplified/Traditional) and English languages.
★ 1TypeScriptupdated 2026-04-13claudeclaude-codejavascript
Manage multiple Anthropic Claude accounts with Claude Code CLI — easily switch accounts in seconds.
★ 14Shellupdated 2026-03-22ai-toolsanthropicanthropic-claudebash-scriptclaude
A modern project scaffold for AI-assisted development workflows—providing reusable Claude Code commands (.claude/commands/), structured AI documentation (ai_docs/), and standardized feature specifications (specs/) to streamline collaboration with Claude Code and OpenAI Codex.
★ 35updated 2025-09-15
CLI tool that scaffolds context engineering documentation for Claude Code projects. Transforms requirements into staged implementation plans, project structures, and workflow rules. From idea to AI-ready project in minutes.
★ 136TypeScriptupdated 2025-08-20
A Claude Code workspace that transforms ideas into multi-format content: research → long-form articles → platform-specific versions (LinkedIn, newsletter, social media, podcast Q&A)
★ 178updated 2025-09-06
I created a claude code deep researcher that seems to work better than the current deep research models
★ 131updated 2025-12-15
Create a data analysis AI agent with Claude Code. Make data analysis as simple as having a chat!​​ 别忘了!claude code也是agent框架,类似langgraph,crewAI,autogen等等agent框架。我改造claude code搞一个数据分析智能体AI。 让数据分析变得像聊天一样简单!
★ 378Pythonupdated 2025-12-21agentagentic-ai
Reduce errors with test-driven development using Browserbase, Stagehand and Claude Code using these sub-agents and output styles
★ 50TypeScriptupdated 2025-08-29
Extract clean conversation logs from Claude Code's internal storage
★ 509Pythonupdated 2026-01-02anthropicclaudeclaude-codecliconversation-export
Lightweight MCP integration bringing Google's Gemini AI capabilities to Claude Code with 1M+ token context window, smart model selection, and powerful code analysis tools
★ 229Pythonupdated 2025-11-16claude-codeclaude-hooksgemini-apigemini-cli
Vibe code with Claude in parallel git worktrees
★ 253TypeScriptupdated 2026-01-02claudeclaude-codedesktop-appgemini-cligit-worktree
ccundo seamlessly integrates with Claude Code to provide granular undo functionality. It reads directly from Claude Code's session files to track file operations and allows you to selectively revert changes with full preview and cascading safety.
★ 1,387JavaScriptupdated 2025-07-27
CodeGate: Security, Workspaces and Multiplexing for AI Agentic Frameworks
★ 785Pythonupdated 2025-06-05aiai-gatewayaisecurityartificial-intelligenceclaude
Claude Code Trace - Export Claude Code chat sessions into markdown and XML
★ 179Pythonupdated 2026-01-06
Claude Multi-Agent Project Management Framework - AI-driven orchestration with LangGraph and OpenAI integration
★ 29Pythonupdated 2025-07-23agenticclaude-codecodeorchestration-framework
Use Claude Code with any LLM provider - GLM-4.5, Kimi-K2, Qwen3-Coder, DeepSeek, etc.
★ 385Pythonupdated 2025-09-16
A browser-based interface for managing multiple Claude Code sessions across Git worktrees.
★ 53TypeScriptupdated 2025-06-12claudeclaudecodetypescript
Connect Claude Code and other AI tools to your Obsidian notes using Model Context Protocol (MCP)
★ 262TypeScriptupdated 2025-06-27
A Docker container for running Claude Code in "dangerously skip permissions" mode.
★ 87Shellupdated 2025-08-19
Claude Code Sub Agent Manager. A simple Manager for adding Claude Code Sub Agents with hooks and custom slash commands.
★ 189JavaScriptupdated 2025-07-28a-agentagentsanthropic-claudeclaudeclaude-ai
An MCP Server for Chrome DevTools, following the Chrome DevTools Protocol. Integrates with Claude Desktop and Claude Code.
★ 297Pythonupdated 2025-10-06chromechromiumchromium-browserclaude-codeclaude-desktop
Ablation study comparing Claude Code configurations
★ 59Pythonupdated 2025-09-08
🎨 A curated collection of Claude AI agent prompts specifically designed for UI/UX design, web development, and frontend tasks. Transform your design workflow with specialized prompts for creating interfaces, components, and user experiences.
★ 511updated 2025-08-08
Implementation of a Spec-Driven Development workflow in Claude Code using custom slash commands
★ 126TypeScriptupdated 2025-07-22
an opinionated approach to productive development with Claude Code
★ 1,531JavaScriptupdated 2025-12-17
Run Anthropic's Claude Code CLI with OpenAI models such as GPT-5-Codex, GPT-5.1, and others via a local LiteLLM proxy.
★ 229Pythonupdated 2026-01-04anthropicclaude-codeclaude-code-adapterclaude-code-cliclaude-code-proxy
Claude Code with any LLM provider (OpenRouter, Gemini, Kimi K2)
★ 66Goupdated 2025-08-16
Your AI butler that get things done
★ 1,486TypeScriptupdated 2026-04-18aibutlerneo4j-graphnodejspostgresql
A Simple Proxy enabling Claude Code to work with OpenRouter
★ 383TypeScriptupdated 2026-01-11
Transform your Claude Code terminal with atomic precision statusline. Features flexible layouts, real-time cost tracking, MCP monitoring, prayer times, and beautiful themes.
★ 432Shellupdated 2026-04-19ai-toolsbashcachingclaude-codecli-tool
Allows to program your home automations in plain english via Claude Code on your computer.
★ 352Pythonupdated 2026-02-08
Comprehensive cross-platform toolkit for Claude Code
★ 130Shellupdated 2025-08-24claude-codecross-platformtoolkit
Happy Coder CLI to connect your local Claude Code to mobile device
★ 537TypeScriptupdated 2026-02-14
The World's Fastest Claude Code Launcher Make Claude Code launching simpler Click Dock to launch, or start from any folder instantly.
★ 625Shellupdated 2026-03-13agentsai-codingclaude-codelauncher
Enhanced Claude Code MCP server with orchestration capabilities, reliability improvements, and self-contained execution patterns
★ 111JavaScriptupdated 2025-05-20
Claude Code LSP: enhance your Claude Code experience with non-IDE dependent LSP integration.
★ 620TypeScriptupdated 2026-02-22claudeclaude-codelspmcpmcp-server
Mobile client for Claude Code.
★ 132Swiftupdated 2026-02-13aiclaudeclaude-apiclaude-codecodeagent
Mobile and Web client for Codex and Claude Code, with realtime voice, encryption and fully featured
★ 19,170TypeScriptupdated 2026-04-20claude-codeclaude-desktopclaude-mobilecodexcodex-cli
From Autocomplete to AI Architect: Mastering Claude Code for Professional Development
★ 213updated 2025-07-01
JSON-driven multi-agent cadence-team development framework with intelligent CLI orchestration (Gemini/Qwen/Codex), context-first architecture, and automated workflow execution
★ 1,898TypeScriptupdated 2026-04-19claudeclaude-codecli-toolscodexcontext-management
The power of Claude Code / GeminiCLI / CodexCLI + [Gemini / OpenAI / OpenRouter / Azure / Grok / Ollama / Custom Model / All Of The Above] working as one.
★ 11,472Pythonupdated 2025-12-15
Transform Claude Code into a complete development platform with AI-powered commands that automate your entire software development workflow.
★ 99JavaScriptupdated 2026-04-07ai-developmentai-toolsautomationclaude-codecode-quality
Use Kimi latest model(kimi-k2-0711-preview) to drive your Claude Code.
★ 1,663Shellupdated 2025-07-15
Enable any LLM (e.g. Claude) to interactively debug any language for you via MCP and a VS Code Extension
★ 507TypeScriptupdated 2025-12-20anthropicautodebugautomationclaudecontext
Claude Code with any LLM
★ 275TypeScriptupdated 2025-08-12agentsaiclaude-codellm
A powerful Telegram bot that provides remote access to Claude Code, enabling developers to interact with their projects from anywhere with full AI assistance and session persistence.
★ 2,498Pythonupdated 2026-03-30
Connect your local Claude Code agent with Slack
★ 157TypeScriptupdated 2025-06-27
Kode Agent — Design for post-human workflows. One unit agent for every human & computer task.
★ 4,965TypeScriptupdated 2026-01-23
A full-featured web-based Claude Code client that provides complete interactive functionality for managing Claude Code projects
★ 1,140TypeScriptupdated 2026-04-13claudeclaude-code
Web-based interface for Claude CLI with streaming chat responses
★ 1,053TypeScriptupdated 2025-11-03claudeclaude-cliweb-ui
Natural (2-way) voice conversations with Claude Code
★ 1,125Pythonupdated 2026-04-19anthropicasrclaudeclaudecodekokoro
★ 7,283TypeScriptupdated 2026-04-20
Always up-to-date Nix package for Claude Code with hourly updates from Anthropic's native releases
★ 354Shellupdated 2026-04-20
Safely constrain and conclude your claude code sessions.
★ 30Rustupdated 2026-03-20bunclaudeclaude-codeclaude-code-hooksnix
My Claude Code toolkit: skills, commands, agents, hooks, and reusable workflow configs. Grab what you need.
★ 7Shellupdated 2026-04-06
Multi-agent orchestration for Claude Code with 15-30% token optimization, self-improving agents, and automatic verification
★ 44TypeScriptupdated 2025-11-24ai-agentsai-poweredautomationclaude-codedatabase-integration
Open source Claude Code web/Codex Cloud/Devin/Ramp Inspect alternative
★ 1,026TypeScriptupdated 2026-04-19
Production-ready Claude Code agents with checklists and MCP integrations.
★ 2Pythonupdated 2026-02-09
A manager for AI coding agents that works with Claude Code, Cursor, Gemini, Codex, and Qwen.
★ 261TypeScriptupdated 2026-03-27agentic-aiaiai-agentsclaudecodex
A Claude Code research infrastructure that enforces citation compliance, validates scientific claims in real-time, and automatically structures your knowledge base.
★ 11Shellupdated 2025-10-21claude-codeliterature-reviewmcpobsidianpubmed
Resumable Working Memory server for Codex/Claude CLI — an MCP backend that captures structured edits, decisions, and artifacts per project and serves compact “resume” bundles so coding agents can pick up exactly where they left off across sessions.
★ 1TypeScriptupdated 2025-10-02
Autonomous Project Management Framework for Claude Code - Advanced AI-powered development automation
★ 33JavaScriptupdated 2026-04-20agentsai-automationclaude-codedevopsnpm-package
A Nix flake providing a secure, isolated environment for running Claude Code using bubblewrap sandboxing.
★ 8Nixupdated 2026-04-18bubblewrapclaudeclaude-codeflakenix
Real-time observability for Claude Code agents with hook event tracking. Monitor multiple agents and visualize data seamlessly. 🌐🚀
★ 6updated 2026-04-20
Claude Code Unified Agents delivers 54 ready sub-agents with orchestration for quick automation in development and AI/ML. Domain org makes discovery easy 🐙
★ 6Shellupdated 2026-04-20neo4j-graphnodejspostgresqlprismaredis
A GitHub Actions project that strategically automates Claude Code session resets. It schedules triggers to align with your work hours, ensuring you get a fresh 5-hour usage window precisely when you need it for maximum productivity.
★ 9Pythonupdated 2026-04-20api-managementautomationclaude-apicron-jobgithub-actions
🛠️ Build and customize Claude Code agents with tools and Docker isolation for efficient production workflows and advanced reasoning capabilities.
★ 4Pythonupdated 2026-04-20agentic-aiagentic-ai-developmentagentsai-agentsanthropic
AI-first deployment platform for Docker applications. Deploy via conversation with Claude Code using the Model Context Protocol (MCP).
★ 1Rustupdated 2025-10-10
Autonomous Server Management with Claude Code - Let AI be your DevOps engineer
★ 20Shellupdated 2025-10-08
Stop AI coding disasters before they cost you weeks. Real-time anti-pattern detection for vibe coders who love AI tools but need a safety net to avoid expensive overengineering traps.
★ 21Pythonupdated 2025-12-02ai-codingai-safetyclaudeclaude-aiclaude-code
A CLI tool for logging and analyzing Claude Code and Cursor ai-driven coding session.
★ 318TypeScriptupdated 2026-04-19ai-assisted-developmentai-codingai-coding-assistantanalysisclaude
The only tool that replays Claude, Codex, Cursor, AND Gemini AI coding sessions in one unified UI. Vibe coding companion for reviewing, searching, and sharing your AI pair programming transcripts.
★ 21TypeScriptupdated 2026-02-03ai-pair-programmingai-transcriptclaudeclaude-codecodex
CLI tool for configuring and monitoring Claude Code
★ 25,430Pythonupdated 2026-04-20anthropicanthropic-claudeclaudeclaude-code
Spec-driven AI development methodology with Claude Code agents and commands (WIP)
★ 2TypeScriptupdated 2026-02-26
Universal bridge for executing AI coding agents (Claude Code, Cursor CLI, Codex CLI) from web applications with secure local communication
★ 1JavaScriptupdated 2025-10-03
(Crystal is now Nimbalyst) Run multiple Codex and Claude Code AI sessions in parallel git worktrees. Test, compare approaches & manage AI-assisted development workflows in one desktop app.
★ 3,034TypeScriptupdated 2026-02-26agentic-aiaiai-codinganthropicclaude
A collection of 100+ specialized Claude Code subagents covering a wide range of development use cases
★ 18,389Shellupdated 2026-04-20ai-agent-frameworkai-agent-toolsai-agentsawesomeawesome-list
The best workflows and configurations I've developed, having heavily used Claude Code since the day of it's release. Workflows are based off applied learnings from our AI-native startup.
★ 3,788updated 2025-09-14
Next.js app for Claude code best practices built with Fumadocs. Document and explore content sources, routes, and MDX docs for fast, scalable docs sites. 🐙
★ 3MDXupdated 2026-04-20agentic-codingai-codingautomationbots-nodeclaude
Non-agentic AI coding
★ 1,369TypeScriptupdated 2026-04-18
Agents, skills, commands, and rules for AI-powered coding tools — used daily to supercharge development productivity.
★ 78Shellupdated 2026-04-17ai-agentsclaude-agentsclaude-aiclaude-code-workflowsclaude-skills
Letting Claude Code develop his own MCP tools :)
★ 121TypeScriptupdated 2025-03-08
Claude Conductor - a simple Claude Code framework
★ 342JavaScriptupdated 2026-03-31aiframeworkautomationclaudeclaude-codeclaudecode
Use Claude Code on Cloudflare to solve GitHub issues
★ 240TypeScriptupdated 2025-06-24
A development framework for Ruby on Rails developers using Claude Code, inspired by SuperClaude
★ 796Rubyupdated 2025-09-26
Claude Code Commands Manager
★ 299TypeScriptupdated 2026-03-13claudeclaude-codecommands
A toolkit of custom commands, hooks, and utilities for Claude Code
★ 693TypeScriptupdated 2026-03-31
A comprehensive collection of development workflow commands for Claude Code
★ 141Shellupdated 2025-07-27
Context manager for all agents
★ 1,153Shellupdated 2026-03-30aiclaude-codecodexcursor
claude-code-provider-proxy
★ 143Pythonupdated 2025-07-30
A collection of production-ready slash commands for Claude Code
★ 2,371updated 2025-10-12aiai-agentsanthropicautomationclaude
★ 173Shellupdated 2025-07-26
A complete collection of 35 specialized sub-agents for Claude Code that enable end-to-end software development automation
★ 185updated 2025-07-30
AI personal assistant setup for Claude Code
★ 128Pythonupdated 2025-08-29
Use Claude Code / CodeX CLI to perform multiple tasks in parallel with a Codex-style UI. Your personal codex/cursor-background agent. Claude Code UI.
★ 517TypeScriptupdated 2025-11-18claude-codecodexcursor-ai
🧠 Context Engineering Research - Not just another agent collection, but using research and context engineering to function as a collective. Hub-and-spoke coordination through Claude Code.
★ 520JavaScriptupdated 2026-04-20agentsai-developmentautonomous-programmingclaudeclaude-code
★ 189JavaScriptupdated 2025-08-07
Transform natural language project rules into Claude Code automation hooks - Write rules in plain English and let Claude automatically generate powerful hooks for code formatting, testing, validation and more
★ 404Pythonupdated 2025-07-01
OpenAI API-compatible wrapper for Claude Code
★ 500Pythonupdated 2026-01-06
Claude Deep Research config for Claude Code.
★ 228updated 2025-03-16
The Claude Code alternative
★ 377TypeScriptupdated 2025-04-23ai-tuiboltnewchatgptclaude-codecli
A CLI tool for analyzing Claude Code/Codex CLI usage from local JSONL files.
★ 13,348TypeScriptupdated 2026-04-20
Cloudflare Worker; Claude Code; Proxy; Easy to deploy; Claude Code Router; claude-code-router; ccr; alternate 【29元500次sonnet,下方wx扫码联系】
★ 268TypeScriptupdated 2025-11-22claudeclaude-codecloudflare-workerproxy
Global Claude Code commands and workflows
★ 501updated 2025-08-11
Easy guide to installing Claude Code MCPs globally on your machine.
★ 239updated 2025-03-19
Claude Code Boost - Hook utilities for Claude Code with intelligent auto-approval
★ 163TypeScriptupdated 2026-03-21
Real-time behavioral enforcement for Claude Code. Monitors AI actions, detects violations, and interrupts misbehavior. Also has a cute pet.
★ 402TypeScriptupdated 2025-10-20agentic-aiagentsclaudeclaude-aiclaude-code
Run Claude Code safely in local Docker containers without having to approve every permission (Archived, see Spritz repo for the continuation of this project)
★ 310TypeScriptupdated 2026-02-20
Practical productivity tools for Claude Code, Codex-CLI, and similar CLI coding agents.
★ 1,744Pythonupdated 2026-04-19claude-codeclicli-agentcode-agentcodex
Our favorite Claude Code commands
★ 502updated 2025-11-24
★ 199updated 2025-08-11
Simplified Gemini for Claude Code.
★ 240Pythonupdated 2025-06-10claude-aigemini-flashmcpmcp-server
A project management framework for AI-assisted development with Claude Code
★ 556TypeScriptupdated 2025-08-26
🤖 Intelligent integration between Claude Code and Google Gemini for large-scale code analysis
★ 401Shellupdated 2025-08-17
PROJECT_INDEX system for Claude Code - provides architectural awareness for AI coding
★ 192Pythonupdated 2025-09-16
Transform Claude Code into a complete development studio with 40+ specialized AI agents, MCP integrations, and enterprise-grade workflows
★ 265JavaScriptupdated 2025-08-12
AI-driven development workflow system built on Claude Code Sub-Agents.
★ 577updated 2025-08-08agentclaude-codemulti-agent-systemworkflow
MCP implementation of Claude Code capabilities and more
★ 299Pythonupdated 2025-08-29claudeclaude-codemcpmcp-server
This python program allows you to use Claude Code with Google's Gemini models.
★ 345Pythonupdated 2026-02-19anthropicclaudeclaude-codegeminigoogle
A set of useful QA agents for Claude Code.
★ 674updated 2025-08-04
Zero-Config Code Flow for Claude code & Codex
★ 5,944TypeScriptupdated 2026-04-02agentaiai-agentbmad-methodccr
Orchestration framework for running 20+ Claude Code agents in parallel: automated bug fixing, best-practices sweeps, lock-based coordination, and real-time tmux monitoring
★ 790Shellupdated 2026-04-06ai-agentsautomationdeveloper-toolspythontmux
Custom slash commands for Claude Code that provide comprehensive development session tracking and documentation
★ 1,186updated 2025-06-16
Seamless integration between Claude Code AI assistant and Neovim
★ 2,021Luaupdated 2026-02-04ai-assistantanthropicclaudeclaude-codeneovim
Unleash Next-Level AI! 🚀 💻 Code Generation: DeepSeek r1 + Claude 3.7 Sonnet - Unparalleled Performance! 📝 Content Creation: DeepSeek r1 + Gemini 2.5 Pro - Superior Quality! 🔌 OpenAI-Compatible. 🌊 Streaming & Non-Streaming Support. ✨ Experience the Future of AI – Today! Click to Try Now! ✨
★ 2,790Pythonupdated 2026-02-23aiclaude-3-7-sonnetdeepseekgemini
A collection of settings to make Claude Code more useful.
★ 1,079Shellupdated 2026-04-15claude-code
Claude Code settings, commands and agents for vibe coding
★ 1,466Pythonupdated 2026-04-17agentic-aiagentsaiclaude-codeclaude-skills
Control Claude Code remotely via email、discord、telegram. Start tasks locally, receive notifications when Claude completes them, and send new commands by simply replying to emails.
★ 1,227JavaScriptupdated 2025-12-06
Shared starter template configuration and CLAUDE.md memory bank system for Claude Code
★ 2,231Pythonupdated 2026-04-19claudeclaude-aiclaude-codeclaudecode-configclaudecode-hooks
Claude Code as one-shot MCP server to have an agent in your agent.
★ 1,247JavaScriptupdated 2026-01-01agentclaudemcp
Beautiful Claude Code Chat Interface for VS Code
★ 1,030JavaScriptupdated 2026-04-17aiai-agentsclaudeclaude-codevibe-coding
Coding assistant MCP for Claude Desktop
★ 1,613Pythonupdated 2025-12-25
The Complete Claude Code CLI Guide - Live & Auto-Updated Every 2 Days
★ 2,631Shellupdated 2026-02-14
★ 497Shellupdated 2025-06-26
🌊 The leading agent orchestration platform for Claude. Deploy intelligent multi-agent swarms, coordinate autonomous workflows, and build conversational AI systems. Features enterprise-grade architecture, distributed swarm intelligence, RAG integration, and native Claude Code / Codex Integration
★ 33,399TypeScriptupdated 2026-04-11agentic-aiagentic-engineeringagentic-frameworkagentic-ragagentic-workflow
Automated workflows for Claude Code. Features spec-driven development for new features (Requirements → Design → Tasks → Implementation) and streamlined bug fix workflow for quick issue resolution (Report → Analyze → Fix → Verify).
★ 3,694TypeScriptupdated 2025-09-07
Claude Code Guide - Setup, Commands, workflows, agents, skills & tips-n-tricks go from beginner to power user!
★ 4,041updated 2026-04-19aiai-agentai-agent-toolsanthropic-claudeclaude
A Tool to Visualize Claude Code's LLM Interactions
★ 2,356JavaScriptupdated 2025-08-26
Real-time Claude Code usage monitor with predictions and warnings
★ 7,787Pythonupdated 2025-09-14aianalyticsclaudeclaude-codeclaude-usage
Run Claude Code on OpenAI models
★ 3,484Pythonupdated 2025-11-19
A configuration framework that enhances Claude Code with specialized commands, cognitive personas, and development methodologies.
★ 22,486Pythonupdated 2026-03-22
★ 61TypeScriptupdated 2025-02-24
★ 245JavaScriptupdated 2025-09-11
Automate your mobile devices with natural language commands - the counterpart android app for the mobilerun framework
★ 304Kotlinupdated 2026-04-17aiai-agentsandroid-automationmobile-automation
MeshCentral Agent for Android Device
★ 61Kotlinupdated 2025-03-29
AgentCPM-GUI: An on-device GUI agent for operating Android apps, enhancing reasoning ability with reinforcement fine-tuning for efficient task execution.
★ 1,355Pythonupdated 2026-01-11
A clean, stateless AI-powered text transformation tool designed for local AI models and OpenAI-compatible APIs. Each transformation is treated as an independent request with no chat history, optimizing performance for local AI inference.
★ 1TypeScriptupdated 2025-09-26
A basic stateless ai chatbot using Google API.
★ 2JavaScriptupdated 2024-12-17
Multi-Agent Conversation Framework in TypeScript
★ 151TypeScriptupdated 2025-04-11agent-based-frameworkagentschatchat-applicationchatbot
Newelle - Your Ultimate Virtual Assistant
★ 1,325Pythonupdated 2026-04-10adwaitaaiappgnomegtk
ChattyUI - your private AI chat for running LLMs in the browser
★ 812TypeScriptupdated 2026-02-07aichatbothuggingfacelocal
Private & local AI personal knowledge management app for high entropy people.
★ 8,558JavaScriptupdated 2025-05-13ailancedbllamallamacpplocal-first
LocalAGI is a powerful, self-hostable AI Agent platform designed for maximum privacy and flexibility. A complete drop-in replacement for OpenAI's Responses APIs with advanced agentic capabilities. No clouds. Local AI that works on consumer-grade hardware (CPU and GPU).
★ 1,761Goupdated 2026-04-15
Local realtime voice AI
★ 2,483Pythonupdated 2025-11-26
Open source Granola AI Alternative
★ 8,331Rustupdated 2026-04-25local-firstnotetakingopen-sourcereactrust
Bytebot is a self-hosted AI desktop agent that automates computer tasks through natural language commands, operating within a containerized Linux desktop environment.
★ 10,865TypeScriptupdated 2025-09-12agentagentic-aiagentsaiai-agents
Claraverse is a opesource privacy focused ecosystem to replace ChatGPT, Claude, N8N, ImageGen with your own hosted llm, keys and compute. With desktop, IOS, Android Apps.
★ 3,800Goupdated 2026-03-01hacktoberfestllmollamaopensourcellmswebui
Local, open-source AI app builder for power users ✨ v0 / Lovable / Replit / Bolt alternative 🌟 Star if you like it!
★ 20,177TypeScriptupdated 2026-04-18ai-app-builderanthropicartificial-intelligenceboltdeepseek
The ultimate no-code platform to build and share AI apps with beautiful UI.
★ 449TypeScriptupdated 2025-05-01aigenerative-aisdfx
Laminar - open-source observability platform purpose-built for AI agents. YC S24.
★ 2,803TypeScriptupdated 2026-04-20agent-observabilityagentsaiai-observabilityaiops
Transform your IP camera into an intelligent baby monitoring system with real-time AI detection, sleep tracking, and safety alerts.
★ 25HTMLupdated 2025-08-17baby-monitorbaby-monitoringchild-monitoringhome-assistanthome-automation
Local Video-LLM powered AI Baby Monitor
★ 500Pythonupdated 2025-05-22baby-monitorvideo-llm
mcp server for homebox
★ 2Goupdated 2025-09-22
Plasma 5 plasmoid showing your gmail feed (based on anthon38/gmailfeed)
★ 18QMLupdated 2019-12-23kdekde-plasma-5plasmaplasma-appletplasma5
Orange Pi Zero3 tools, projects, images and resources
★ 54updated 2024-07-12opi-zero3orange-piorangepiorangepi-zero3orangepizero3
★ 155updated 2025-07-01
MDocAgent: A Multi-Modal Multi-Agent Framework for Document Understanding
★ 326Pythonupdated 2025-08-08
Backlog.md - A tool for managing project collaboration between humans and AI Agents in a git ecosystem
★ 5,403TypeScriptupdated 2026-04-13agentagentic-aimanagementmarkdownproject
My agents instruction files, grouped by tech
★ 40JavaScriptupdated 2026-02-21
Curated list of real‑world AGENTS.md files, templates, guides & tools for OpenAI Codex‑based agents.
★ 47updated 2025-08-20agents-mdawesome-listdocumentationopenai-codexprompt-engineering
A Home Assistant custom component that provides an AI-powered agent capable of generating automations based on natural language queries. The agent connects to all entities in your Home Assistant instance and uses OpenAI's or Llama API to translate user requests into valid Home operations including creating automations for you!
★ 115Pythonupdated 2026-04-20aiai-agenthacshacs-integrationhome-assistant
Shinkai allows you to create AI agents without touching code. Define tasks, schedule actions, and let Shinkai write custom code for you. Native crypto support included.
★ 67Rustupdated 2026-04-19aichatgptguillama3llm
:aerial_tramway: JavaScript websocket client for Home Assistant
★ 389TypeScriptupdated 2026-04-13home-assistanthome-automationinternet-of-thingsjavascriptwebsocket
Read-only mirror of https://gitlab.gnome.org/World/Phosh/phosh
★ 153Cupdated 2026-04-20gnomegtkmobilephoshwayland
Chromium kiosk is simple package turning your Archlinux or Debian (and alike) based PC/Raspberry into simple web kiosk using chromium.
★ 110Pythonupdated 2026-01-19
Shows a web page in kiosk mode by a given url as parameter. Uses WebView2 (Edge Chromium) as an engine.
★ 46C#updated 2025-12-17csharpwebview2wpf
🙈 Hides the Home Assistant header and/or sidebar
★ 709TypeScriptupdated 2026-04-19customizationhacs
DietPi Web Kiosk
★ 3Shellupdated 2024-10-23
Home Assistant Touch Panel Kiosk application for a Linux device (e.g. Raspberry Pi) with Touch Display.
★ 1,312JavaScriptupdated 2026-04-17home-assistantkiosk-touchscreenraspberry-pi
Frontend card for use on HomeAssistant alongside the AmpliPi integration.
★ 4JavaScriptupdated 2025-08-01
A simple Custom Card for Home Assistant to toggle switches, lights & more!
★ 5TypeScriptupdated 2023-09-10buttoncardcardsclickcustom
Wraps another Home Assistant card to add tap, hold, and double-tap actions
★ 31JavaScriptupdated 2025-12-04actionscardcardscustom-cardfrontend
Add custom styles to any frontend Home Assistant element through themes.
★ 21JavaScriptupdated 2026-04-20homeassistanthomeassistant-custom-componenthomeassistant-frontend
A minimalistic Mushroom-based dashboard for Home Assistant, adaptive for mobile and tablet/desktop and for light and dark mode.
★ 140updated 2024-03-10adaptivefrontendhome-assistanthome-assistant-dashboardhome-assistant-theme
An area card for home assistant dashboards
★ 97TypeScriptupdated 2026-04-18frontendhacshome-assistantlovelaceplugin
Home Assistant Card to display the LLM Vision Timeline
★ 95updated 2026-03-23custom-carddashboardfrontendhome-assistantllmvision
A status card for home assistant dashboards
★ 284TypeScriptupdated 2026-04-18frontendhacshomeassistantlovelaceplugin
Bubble Card is a minimalist card collection for Home Assistant with a nice pop-up touch.
★ 4,141JavaScriptupdated 2026-04-16buttoncardcardscustom-cardcustom-cards
:lollipop: Frontend for Home Assistant
★ 5,421TypeScriptupdated 2026-04-20frontendhacktoberfesthome-assistanthome-automationlit-element
Official React Component for Font Awesome Icons
★ 3,734TypeScriptupdated 2026-04-20fontawesomefrontendjavascriptreact
A curated list of awesome frontend development resources.
★ 436updated 2026-02-10
A curated list of amazingly awesome frontend libraries, resources and shiny things.
★ 1,726updated 2024-05-11awesome
Material UI: Comprehensive React component library that implements Google's Material Design. Free forever.
★ 98,235JavaScriptupdated 2026-04-20design-systemmaterial-designmaterial-uireactreact-components
This repo contains core (HTML/CSS) implementation for PatternFly. Issues related to CSS/HTML and layout should be filed here.
★ 795SCSSupdated 2026-04-17hacktoberfest
An enterprise-class UI design language and React UI library
★ 97,845TypeScriptupdated 2026-04-20ant-designantddesign-systemsreacttypescript
Home Assistant card for controlling the Alarmo component
★ 164TypeScriptupdated 2026-03-08alarmalarmoassistantcardhome
🖼️ Wall panel mode and photo screensaver for your Home Assistant Dashboards
★ 822JavaScriptupdated 2026-03-01dashboardfullscreenhome-assistanthome-assistant-addonshome-assistant-frontend
🏠 - A modern, minimalistic dashboard for Home Assistant
★ 476updated 2025-12-31homeassistant
Build a beautiful Home Assistant dashboard easily
★ 4,945TypeScriptupdated 2026-03-08cardhacktoberfesthacshome-assistantlovelace
Curated list of awesome SmartHome/Home Automation things (open and leaving users in control)
★ 555updated 2022-06-15awesomeawesome-listhome-automationiotsmarthome
An fully auto generating Home Assistant UI dashboard for desktop, tablet and mobile by Dwains for desktop, tablet, mobile
★ 2,032JavaScriptupdated 2025-09-01dashboarddwains-lovelace-dashboardhome-assistanthome-assistant-dashboard
A modern, easy-to-use and performant custom Home Assistant dashboard
★ 2,952Svelteupdated 2025-01-01dashboardhome-assistant
A low profile split keyboard designed to satisfy one single use case elegantly
★ 1,246Pythonupdated 2024-04-07
Easy to use, but flexible, Wayland Compositor
★ 647C++updated 2026-04-20
KDE's screen management software
★ 57C++updated 2026-04-17
Chrome extension that allows you to manage your Github stars with tags, and to create a bookmark folder with all your stars organized by the tags you created
★ 235JavaScriptupdated 2018-05-24bookmarkchromechrome-browserextensiongithub-stars
Your Personal AI-Powered Information Hub
★ 2,312TypeScriptupdated 2026-04-19extension-chromegithubpocketreactrss
An app for managing github starred repositories.
★ 1,910TypeScriptupdated 2026-04-20
Open Source Lovable
★ 727TypeScriptupdated 2026-03-19agentsaicode-generation
Biomni: a general-purpose biomedical AI agent
★ 3,020Pythonupdated 2026-04-13agentaibiomedicine
🌸 Best framework to build web agents, and deploy serverless web automation functions on reliable browser infra.
★ 1,939Pythonupdated 2026-04-17agentaianthropicautomationbrowser
AI Agent Builder and Runtime by Docker Engineering
★ 2,854Goupdated 2026-04-20agentsai
A list of AI agents and robots to block.
★ 3,837Pythonupdated 2026-03-27aicrawlerscrawlingprivacy
An AI-powered data science team of agents to help you perform common data science tasks 10X faster.
★ 5,178Pythonupdated 2026-01-28agentsaiai-engineerai-engineeringcopilot
HexStrike AI MCP Agents is an advanced MCP server that lets AI agents (Claude, GPT, Copilot, etc.) autonomously run 150+ cybersecurity tools for automated pentesting, vulnerability discovery, bug bounty automation, and security research. Seamlessly bridge LLMs with real-world offensive security capabilities.
★ 8,298Pythonupdated 2026-03-060x4m4aiai-agentsai-cybersecurityai-hacking
MCP server to provide Figma layout information to AI coding agents like Cursor
★ 14,521TypeScriptupdated 2026-04-16aicursorfigmamcptypescript
ZenML 🙏: One AI Platform from Pipelines to Agents. https://zenml.io.
★ 5,362Pythonupdated 2026-04-20agentopsagentsaiautomldata-science
Deploy serverless AI workflows at scale. Firebase for AI agents
★ 6,603Jupyter Notebookupdated 2026-03-13agentsaiai-agentsai-agents-frameworkai-memory
Node CI is used to verify the links in IPTV playlists.
★ 54JavaScriptupdated 2026-04-17
★ 11,518Pythonupdated 2026-04-16
A community driven registry service for Model Context Protocol (MCP) servers.
★ 6,732Goupdated 2026-04-17mcpmcp-servers
Script that adds MQTT discovery support for Shellies Gen2+ devices
★ 174Pythonupdated 2026-04-14discoveryhacktoberfesthome-assistantmqttpython
Wrap Gemini CLI, Antigravity, ChatGPT Codex, Claude Code as an OpenAI/Gemini/Claude/Codex compatible API service, allowing you to enjoy the free Gemini 2.5 Pro, GPT 5, Claude model through API
★ 28,783Goupdated 2026-04-20antigravityclaude-codecluadecodexgemini
An MCP server to communicated with, use, and wrap the API for the OpenAI Codex CLI tool.
★ 53Pythonupdated 2025-04-18
GPT-5 coding examples
★ 1,877HTMLupdated 2025-12-11codexcodingfrontendgptopenai
Fully open-source command-line AI assistant inspired by OpenAI Codex, supporting local language models.
★ 678Pythonupdated 2025-07-07
Mobile UI components made with Tailwind CSS
★ 4,149JavaScriptupdated 2026-04-17androidiosmaterial-designmobilereact
UI building blocks to add email, calendar, and contacts to your app in minutes.
★ 96Svelteupdated 2024-09-04agendacalendarcomposercontact-listlerna
Starter repo to get started with Sveltekit and Contentful
★ 18Svelteupdated 2025-11-26contentful-apigoogle-mapsgraphqlsveltekit
🪄 Create beautiful presentations with Svelte
★ 1,704Svelteupdated 2026-04-17animotionpresentationrevealslidessvelte
Markdown parser to svelte components
★ 391JavaScriptupdated 2024-07-17
Simple elegant toast notifications
★ 895Svelteupdated 2025-01-22svelte3toast-notificationsvanilla-js
The Svelte Language Server, and official extensions which use it
★ 1,417TypeScriptupdated 2026-04-03language-serversveltevscode-extension
Magical utilities for your Svelte applications.
★ 1,780TypeScriptupdated 2026-03-04runessveltesvelte-5svelte-5-helperssvelte-5-utilities
A utility-first CSS framework for rapid UI development.
★ 94,759TypeScriptupdated 2026-04-20csscss-frameworkfunctional-csspostcssresponsive
Collection of Svelte components to build highly interactive applications.
★ 1,100Svelteupdated 2026-04-14sveltesvelte-components
Write components once, run everywhere. Compiles to React, Vue, Qwik, Solid, Angular, Svelte, and more.
★ 13,813TypeScriptupdated 2026-01-13angularbuildercompilerdeclarativefigma
Unstyled, accessible UI components for your design System. Works in React, Vue, Solid, and Svelte.
★ 5,137TypeScriptupdated 2026-04-20componentsdesign-systemheadlessprimitivesreact
🤖 Headless UI for building powerful tables & datagrids for TS/JS - React-Table, Vue-Table, Solid-Table, Svelte-Table
★ 27,926TypeScriptupdated 2026-04-18datagriddatagridsdatatablefilteringgrid
The Svelte CLI
★ 472TypeScriptupdated 2026-04-17clisvsveltesvelte-migrate
Build performant, native and cross-platform desktop applications with native Svelte + powerful CSS-like styling.🚀
★ 2,833TypeScriptupdated 2025-03-18cross-platformdesktop-applicationsnodeguiqtsvelte
Awesome examples of SvelteKit in the wild
★ 1,286TypeScriptupdated 2026-04-17awesome-listcommunitysveltesvelte-kit
A set of headless, accessible component builders for Svelte.
★ 4,152TypeScriptupdated 2025-09-30component-libraryheadlesssveltetypescript
A soup-to-nuts interactive tutorial on how to build apps with Svelte
★ 542Svelteupdated 2024-08-14
⚡ A curated list of awesome Svelte resources
★ 2,090updated 2026-04-13awesomeawesome-listsappersveltesveltejs
The headless components for Svelte.
★ 3,230TypeScriptupdated 2026-04-18component-librarycomponentsheadlessheadlessuisvelte
Automated Svelte routes
★ 1,983JavaScriptupdated 2026-01-07hacktoberfest
Notus Svelte: Free Tailwind CSS UI Kit and Admin
★ 873Svelteupdated 2024-06-08adminadmin-dashboarddashboardkitnotus
Official Svelte components built for Flowbite and Tailwind CSS
★ 2,745CSSupdated 2026-04-07accordionbuttonscardscomponentsdark-mode
3D framework for Svelte
★ 3,240Svelteupdated 2026-04-203dhacktoberfestrapiersveltetheatrejs
ONVIF Network Interface Specifications
★ 419XSLTupdated 2026-04-20hacktoberfestonvifonvif-specifications
Raspberry Pi Onvif Server
★ 747JavaScriptupdated 2026-01-03
ONVIF Client Implementation in Python
★ 528Pythonupdated 2024-08-08
ONVIF node.js implementation
★ 773JavaScriptupdated 2026-02-18hacktoberfestjavascriptnvtonvifptz
Control IP cameras through MQTT reliably. Supports ONVIF (motion) and HTTP (reolink) control APIs.
★ 52Scalaupdated 2024-12-19
web development, streamlined
★ 20,461JavaScriptupdated 2026-04-19svelte
Svelte Material UI Components
★ 3,423Svelteupdated 2026-03-08materialmaterial-designmaterial-uisveltesvelte-components
shadcn/ui, but for Svelte. ✨
★ 8,661TypeScriptupdated 2026-04-17bits-uishadcn-svelteshadcn-uisveltesvelte-5
web development for the rest of us
★ 86,425JavaScriptupdated 2026-04-17compilertemplateui
Cross-Platform React Native UI Toolkit
★ 25,817MDXupdated 2026-01-27androidcross-platformhacktoberfestiosmobile-app
Turn off monitors to save power (for Wayland)
★ 35Rustupdated 2025-03-16rustwaylandwlroots
A curated list of awesome Android UI/UX libraries
★ 55,910updated 2024-07-06androidawesomeui
👩‍💻👨‍💻 Awesome cheatsheets for popular programming languages, frameworks and development tools. They include everything you should know in one single file.
★ 45,703JavaScriptupdated 2026-04-12backendbashcheatsheetcheatsheetsdatabase
:zap: Delightful Node.js packages and resources [BECAUSE OF TOO MUCH SPAM AND LOW-QUALITY SUBMISSIONS, SUBMISSIONS ARE PAUSED UNTIL SEPTEMBER]
★ 65,518updated 2026-04-02awesomeawesome-listjavascriptlistnode
An awesome list that curates the best Flutter libraries, tools, tutorials, articles and more.
★ 59,769Dartupdated 2026-02-11androidawesomeawesome-listcollectionscross-platform
🎉 The best resources related to Vuetify
★ 1,747updated 2025-07-01applicationsawesomeawesome-listguideplugins
Awesome Docker Compose samples
★ 44,991HTMLupdated 2026-04-10awesomeawesome-listdocker-compose
A curated list of awesome Machine Learning frameworks, libraries and software.
★ 72,295Pythonupdated 2026-04-12
🎉 A curated list of awesome things related to Vue.js
★ 73,607updated 2026-03-27
A collection of awesome penetration testing resources, tools and other shiny things
★ 25,958updated 2026-01-25awesomeawesome-list
The iconic SVG, font, and CSS toolkit
★ 76,531JavaScriptupdated 2026-02-10cssfontfontawesomeiconssvg-icons
awesome window manager
★ 6,869Luaupdated 2026-04-08awesomewmchacktoberfestluawindow-manager
gcal/outlook like calendar component
★ 8,684JavaScriptupdated 2025-06-16
Your definitive source for dashboard icons.
★ 8,045TypeScriptupdated 2026-04-13dashboarddashboard-iconsdashydockerheimdall
Data Apps & Dashboards for Python. No JavaScript Required.
★ 24,149Pythonupdated 2026-04-17bioinformaticschartingdashdata-sciencedata-visualization
Polished, feature rich, accessible form inputs built with React
★ 2,362TypeScriptupdated 2025-01-02componentformsinputsreact
Qt Base (Core, Gui, Widgets, Network, ...)
★ 3,013C++updated 2026-04-20c-plus-plusqtqt5
Syncfusion Flutter widgets libraries include high quality UI widgets and file-format packages to help you create rich, high-quality applications for iOS, Android, and web from a single code base.
★ 1,775Dartupdated 2026-03-19
Build interactive dashboards in minutes.
★ 8,892TypeScriptupdated 2026-04-16angulardashboardgridgridsterjavascript
Custom your personal browser start page from some configurable components.
★ 1,049Vueupdated 2026-03-19browser-start-pagechromechrome-extensioncomponentdashboard
Free Bootstrap 5 Admin Dashboard Template
★ 21,329HTMLupdated 2026-02-15adminadmin-dashboardadmin-dashboard-templateadmin-dashboard-uiadmin-panel
A fancy self-hosted digital signage tool. Simple and working
★ 66Shellupdated 2026-01-21dashboardkioskmonitorraspberrypiscreen
Concerto Digital Signage System
★ 459Rubyupdated 2026-04-16bulletin-boarddigital-signage
mouse & keyboard sharing via LAN
★ 4,748Rustupdated 2026-04-09gplv3gtk4-rshyprlandkeyboard-emulationkvm-switch
KVM - Share Mouse & Keyboard between multiple computers. Custom borders and more!
★ 401updated 2026-02-14cross-platformcursordisplaykvmkvm-switch
InputShare enables you to share the keyboard and mouse of your computer with an Android device via ADB in wired / wireless way.
★ 564Pythonupdated 2026-01-11android-controlkeyboard-mousewireless-control
Share a single keyboard and mouse between multiple computers.
★ 25,434C++updated 2026-04-20keyboardkeyboard-emulationmousemouse-emulationnetwork
List of groups that are carrying out cyber actions in the conflict between Israel and Iran.
★ 34updated 2026-02-12
CLI Text Search across your infrastructure platforms, Universal Ctrl+F for infra
★ 114Goupdated 2025-03-05awsdevopsdynamodbelasticsearchgolang
[TMLR] A curated list of language modeling researches for code (and other software engineering activities), plus related datasets.
★ 3,312updated 2026-04-10aiawesomedatasetsllmnlp
Label printing software
★ 167Pythonupdated 2026-04-13
A Label Printer Application
★ 330Cupdated 2026-02-04dymoippzpl
Easily print labels with a Brother label printer.
★ 66PHPupdated 2023-09-30brother-label-printercomposerlabel-printerphp
A Python-based web service to print labels on Brother QL label printers. Based on brother_ql: https://github.com/pklaus/brother_ql
★ 311Pythonupdated 2023-08-09brother-qllabel-printingql-500ql-700ql-710w
DockFlare: Automate Cloudflare Tunnels with Docker Labels
★ 1,959Pythonupdated 2026-04-19api-integrationautomationcloudflarecloudflare-accesscloudflare-dns
Print SeedSigner seeds using the Brother QL-700 label printer attached to a Raspberry Pi
★ 3Shellupdated 2021-11-26
Brother PTouch QL-700 printer CUPS Driver
★ 2Shellupdated 2020-01-25
A command line utility that can print 1083 by 336 pixel PNG files on Brother QL-570 and QL-700 thermal label printers
★ 6Cupdated 2016-06-29
Python package for the raster language protocol of the Brother QL series label printers (QL-500, QL-550, QL-560, QL-570, QL-700, QL-710W, QL-720NW, QL-800, QL-810W, QL-820NWB, QL-1050, QL-1060N and more).
★ 683Pythonupdated 2026-01-09brotherbrother-label-printerbrother-qllabel-printerprinter
💫 Toolkit to help you get started with Spec-Driven Development
★ 90,896Pythonupdated 2026-04-17aicopilotdevelopmentengineeringprd
Elixir implementation of a LangChain style framework that lets Elixir projects integrate with and leverage LLMs.
★ 1,146Elixirupdated 2026-04-18aianthropicbumblebeechatgptclaude-ai
Building Apps with LLMs
★ 1,135Jupyter Notebookupdated 2024-02-11ailangchainlangchain-pythonpythonslack-bot
★ 2,573Jupyter Notebookupdated 2026-04-16
Langchain + Docker + Neo4j + Ollama
★ 5,285Pythonupdated 2026-03-30
🌟DataTonic : A Data-Capable AGI-style Agent Builder of Agents , that creates swarms , runs commands and securely processes and creates datasets, databases, visualisations, and analyses.
★ 95Jupyter Notebookupdated 2025-07-19agent-builderagiautogenazurechroma
Open-source framework for developing real-time multimodal conversational AI agents.
★ 617Pythonupdated 2026-04-20
Custom subagents to use with Claude Code.
★ 2,045updated 2025-07-25
A fast and lightweight framework for creating decentralized agents with ease.
★ 1,586Pythonupdated 2026-04-17agentsaiai-agentsllmmulti-agent-systems
What are the principles we can use to build LLM-powered software that is actually good enough to put in the hands of production customers?
★ 19,489TypeScriptupdated 2025-09-2112-factor12-factor-agentsagentsaicontext-window
A powerful TypeScript framework for building non-deterministic AI agents with advanced cognitive capabilities like reasoning, decision-making, and inter-agent collaboration within the OpenServ platform. Built with strong typing, extensible architecture, and a fully autonomous agent runtime.
★ 130TypeScriptupdated 2026-02-12
Sample application to add voice capabilities to the Agents SDK
★ 252TypeScriptupdated 2025-05-13
Deploy headless browsers in Docker. Run on our cloud or bring your own. Free for non-commercial uses.
★ 13,021TypeScriptupdated 2026-04-20browserlesschromedockerfirefoxnodejs
Netlify's Official MCP server
★ 41TypeScriptupdated 2026-03-09
AgentKit is a toolkit that gives AI agents access to crypto wallets and onchain functionality. Powered by the 0xGasless AgentKit SDK.
★ 415TypeScriptupdated 2026-01-29aiaiagentsaiagentsframework
A powerful Go framework for building production-ready AI agents!
★ 560Goupdated 2026-04-17agentic-aiagentsframeworkgolang
★ 1,911Pythonupdated 2025-09-30
Qwen-Image is a powerful image generation foundation model capable of complex text rendering and precise image editing.
★ 7,815Pythonupdated 2026-02-10
The official repo of Qwen2-Audio chat & pretrained large audio language model proposed by Alibaba Cloud.
★ 2,064Pythonupdated 2025-04-21
Qwen3 is the large language model series developed by Qwen team, Alibaba Cloud.
★ 27,170Pythonupdated 2026-01-09
🌊 AChat - An open-source/self-hosted/local-first AI platform, designed for enterprises and teams, perfectly combining powerful local processing capabilities with seamless remote synchronization.
★ 3,257TypeScriptupdated 2026-04-17agentaichatchatbotclaude
★ 61Pythonupdated 2025-02-13
NTAG21X(NTAG213, NTAG215, NTAG216) full-featured driver library for general-purpose MCU and Linux.
★ 38Cupdated 2026-01-25cfull-featured-driverlinuxmcuntag213
This project contains scripts for writing data to and verifying data on NTAG215 NFC using acr1252
★ 13Pythonupdated 2024-04-23
A modern, type-safe TypeScript library for creating and parsing NDEF (NFC Data Exchange Format) messages with full compile-time type checking and intelligent autocompletion.
★ 1TypeScriptupdated 2026-01-11
Python NDEF (NFC Data Exchange Format) encoder, decoder and verifier
★ 12Pythonupdated 2024-01-25
A Dart library to decode & encode NDEF records, supporting multiple types.
★ 14Dartupdated 2026-03-14dartdart-librarydart-packageflutterndef
Python package for parsing and generating NFC Data Exchange Format messages.
★ 68Pythonupdated 2020-09-07ndefndef-librarypythonpython-library
Kodezi Chronos is a debugging-first language model that achieves state-of-the-art results on SWE-bench Lite (80.33%) and 67% real-world fix accuracy, over six times better than GPT-4. Built with Adaptive Graph-Guided Retrieval and Persistent Debug Memory. Model available Q1 2026 via Kodezi OS.
★ 4,945Javaupdated 2025-11-12artificial-intelligenceautonomous-debuggingbenchmarkbenchmark-reportbug-fixing
Multi-Agent Debugger: An AI-powered debugging system using CrewAI to orchestrate specialized agents that analyze logs, trace code, and uncover root causes across your stack — powered by LLM providers.
★ 35Pythonupdated 2025-07-22ai-toolsautonomous-agentscode-analysiscrewaidebugging
PentestAgent is an AI agent framework for black-box security testing, supporting bug bounty, red-team, and penetration testing workflows.
★ 2,136Pythonupdated 2026-04-12aiai-agentsai-assistantai-cybersecurityai-hacking
All-in-one local low-code AI agent development platform. Installs and runs n8n, Flowise, Browser-Use, Qdrant, Ollama, and more. Proxies LLM requests through LiteLLM with Langfuse for observability.
★ 142TypeScriptupdated 2026-02-03
Lemon AI is the first Full-stack Open-source Self-Evolving General AI Agent, offering a fully local alternative to Agentic platforms like Manus & Genspark AI.🔔 Official updates X(twitter) @LemonAI_cc
★ 1,507JavaScriptupdated 2026-02-03agentagentic-aiaidesktopfullstack
Local AI-powered code review agents for Claude Code
★ 42updated 2025-08-28adlcagentsaiai-agentsautomation
An autonomous LLM-agent for large-scale, repository-level code auditing
★ 377Pythonupdated 2026-03-12code-auditingneuro-symbolic-static-analysissecurity-tools
A source-available, agent coding ready, project management platform
★ 170Shellupdated 2026-02-06project-management
A curated collection of system prompts and tool definitions from production AI coding agents
★ 164Jinjaupdated 2025-08-04claude-codegemini-cliprompt-engineeringsystem-prompts
Claude Code Workflow for beginners & intermediate users. Tutorial and Installer included
★ 1,343Shellupdated 2026-04-07
An in-depth book and reference on building agentic systems like Claude Code
★ 309CSSupdated 2025-06-05agentagentic-aiaiclaudemcp
Ruby gems for general-purpose AI agent systems: automation, research, data processing, customer support, content creation. SwarmSDK provides single-process orchestration, persistent memory with semantic search, node workflows, and hooks. SwarmMemory/SwarmCLI included. Claude Swarm v1 for dev teams.
★ 1,707Rubyupdated 2026-02-17
Your agent in your terminal, equipped with local tools: writes code, uses the terminal, browses the web. Make your own persistent autonomous agent on top!
★ 4,280Pythonupdated 2026-04-20agentagentsai-agentsai-assistantanthropic
Quantalogic ReAct Agent - Coding Agent Framework - Gives a ⭐️ if you like the project
★ 465Pythonupdated 2025-12-02agentsaigenerative-ai
Use Claude Code, Cursor CLI or Codex on mobile and web with CloudCLI (aka Claude Code UI). CloudCLI is a free open source webui/GUI that helps you manage your Claude Code session and projects remotely
★ 10,229TypeScriptupdated 2026-04-20anthropicanthropic-aianthropic-claudeclaudeclaude-api
A curated list of awesome skills, hooks, slash-commands, agent orchestrators, applications, and plugins for Claude Code by Anthropic
★ 41,078Pythonupdated 2026-04-20agent-skillsagentic-codeagentic-codingai-workflow-optimizationai-workflows
Comprehensive resources on Generative AI, including a detailed roadmap, projects, use cases, interview preparation, and coding preparation.
★ 2,239Jupyter Notebookupdated 2026-04-18agentic-aiagentic-frameworkclaudegeminigenai
AI-powered code assistant for Vim. OpenAI and ChatGPT plugin for Vim and Neovim.
★ 1,159Pythonupdated 2026-03-11chatgptcode-generationgeminigpt-4llm
AI coding tools that give free Claude Opus/Sonnet, GPT-5, Gemini Pro, and other pro-grade models
★ 688JavaScriptupdated 2025-12-05aiai-toolsawesome-listcode-generationcoding-assistant
Free, local, open-source 24/7 Cowork app and OpenClaw for Gemini CLI, Claude Code, Codex, OpenCode, Qwen Code, Goose CLI, Auggie, and more | 🌟 Star if you like it!
★ 22,574TypeScriptupdated 2026-04-20acpaiai-agentchatchatbot
The official repository for the AiiDA code
★ 560Pythonupdated 2026-04-20aiidacomputational-sciencedata-provenancedatabaseprovenance
Platform for AI-powered software engineers
★ 1,173TypeScriptupdated 2026-04-20aiai-codingai-coding-toolsai-developer-toolsai-development
AI & parametric QR code generator. AI & 参数化二维码生成器。https://qrbtf.com
★ 6,910TypeScriptupdated 2025-04-17art-qrart-qr-codeart-qrcodegeneratorqr
Low-code framework for building custom LLMs, neural networks, and other AI models
★ 11,677Pythonupdated 2026-04-19computer-visiondata-centricdata-sciencedeepdeep-learning
aide source code
★ 708Cupdated 2026-01-31
code powering the comma.ai panda
★ 1,666Cupdated 2026-04-18
A curated list of vibe coding references, collaborating with AI to write code.
★ 3,973updated 2026-04-16ai-agentai-agentsai-coding-assistantai-coding-toolsawesome
Awesome AI Coding
★ 768updated 2026-03-02aiawesomeawesome-listcodingcopilot
Replace Copilot local AI
★ 2,083TypeScriptupdated 2024-05-13
Kilo is the all-in-one agentic engineering platform. Build, ship, and iterate faster with the most popular open source coding agent.
★ 18,577TypeScriptupdated 2026-04-20aiai-ageai-codingai-developer-toolschatgpt
Open-source CLI coding agent, a free alternative to Claude Code. Generate, debug, and manage code seamlessly.
★ 358Rustupdated 2025-10-30agentclaude-codeclicli-agentcode-agent
AgenticSeek is a fully local, voice-enabled AI assistant designed to autonomously browse the web, write code, and plan tasks while ensuring complete privacy by keeping all data on your device. Tailored for local reasoning models, it runs entirely on your hardware, eliminating any cloud dependency.
★ 30Pythonupdated 2025-08-27ai-agentsai-assistantautonomous-web-browsingchromedrivercoding-assistance
Nexent is a zero-code platform for auto-generating production-grade AI agents using Harness Engineering principles — unified tools, skills, memory, and orchestration with built-in constraints, feedback loops, and control planes.
★ 4,360Pythonupdated 2026-04-20agentagentic-aiagentic-frameworkagentic-ragagentic-workflow
AI Vibe Coding Agent of TS backend server, enhanced by compiler skills, generating 100% working code
★ 1,316TypeScriptupdated 2026-04-16ai-coding-agentall-in-oneautomationbackendgenerated-api
DocAgent is a system designed to generate high-quality, context-aware code documentation for Python codebases using a multi-agent approach and hierarchical processing.
★ 430Pythonupdated 2025-04-23
Project management skill system for Agents that uses GitHub Issues and Git worktrees for parallel agent execution.
★ 8,030Shellupdated 2026-03-18ai-agentsai-codingclaudeclaude-codeproject-management
Claudable is an open-source web builder that leverages local CLI agents, such as Claude Code, Codex, Gemini CLI, Qwen Code, and Cursor Agent, to build and deploy products effortlessly.
★ 3,902TypeScriptupdated 2026-04-11agentclaudeclaude-codecodexcodingagent
Low code tool to rapidly build and coordinate multi-agent teams
★ 1,078TypeScriptupdated 2025-10-27agent-based-frameworkagent-oriented-programmingagenticagentic-agiai
🤖 AI-powered software engineering multi-agent system with researcher and developer agents that automate code implementation through intelligent planning and execution. Built with LangGraph multi-agent workflows
★ 628Pythonupdated 2026-03-28
Scale your compute with Claude Code as a programmable agentic coding tool
★ 297Pythonupdated 2025-06-06
✅2-in-1 AI Developer and Project Manager. AI agents plan an entire project in Todoist and code it task by task.
★ 574Pythonupdated 2025-10-02agentaiclicode-generationcode-writing
LLaVA-Plus: Large Language and Vision Assistants that Plug and Learn to Use Skills
★ 766Pythonupdated 2024-02-01agentlarge-language-modelslarge-multimodal-modelsmultimodal-large-language-modelstool-use
Python wrapper for the Codegen API - run code agents at scale
★ 521Pythonupdated 2026-04-16agentspythonsdk
Real-time monitoring for Claude Code agents through simple hook event tracking.
★ 1,386Pythonupdated 2026-02-08
A list of Claude Code Sub-Agents submitted by the community.
★ 1,232updated 2025-11-10
An Open-Source Asynchronous Coding Agent
★ 9,659Pythonupdated 2026-04-19agentagentsaianthropicclaudecode
extendable code review and QA agent 🚢
★ 2,351TypeScriptupdated 2025-11-24agentagentscicdcode-qualitycode-review
AGENTS.md — a simple, open format for guiding coding agents
★ 20,636TypeScriptupdated 2026-03-12
"DeepCode: Open Agentic Coding (Paper2Code & Text2Web & Text2Backend)"
★ 15,270Pythonupdated 2026-04-20agentic-codingllm-agent
Manage multiple AI terminal agents like Claude Code, Codex, OpenCode, and Amp.
★ 7,162Goupdated 2026-03-28claude-codeclicodexopencodevibe-coding
Kodu is an autonomous coding agent that lives in your IDE. It is a VSCode extension that can help you build your dream project step by step by leveraging the latest technologies in automated coding agents
★ 5,277TypeScriptupdated 2025-04-30chatgptclaudecoding-agentsllmopenai
A web UI for Claude Code agents
★ 1,148TypeScriptupdated 2026-03-20agentaiclaudeclaude-codemcp
Multi-agent orchestration workflow (Claude Code Codex Gemini OpenCode)
★ 2,620Goupdated 2026-04-09
Ruler — apply the same rules to all coding agents
★ 2,663TypeScriptupdated 2026-04-15agentsaiaiderclaude-codecodex
Run Claude Code, Gemini, Codex — or any coding agent — in a clean, isolated sandbox with sensitive data redaction and observability baked in.
★ 1,772TypeScriptupdated 2026-01-13agentaiclaude-codecodexgemini-cli
Collection of specialized AI subagents for Claude Code for personal use (full-stack development).
★ 1,549updated 2025-08-15ai-agentsclaude-codeclaudecode-configclaudecode-subagentssub-agents
The first "code-first" agent framework for seamlessly planning and executing data analytics tasks.
★ 6,151Pythonupdated 2026-03-23agentai-agentscode-interpretercopilotdata-analysis
HTTP API for Claude Code, Goose, Aider, Gemini, Amp, and Codex
★ 1,372Goupdated 2026-04-13
★ 1,264updated 2026-03-19agentscli
Development environments for coding agents. Enable multiple agents to work safely and independently with your preferred stack.
★ 3,747Goupdated 2026-02-23
Code search MCP for Claude Code. Make entire codebase the context for any coding agent.
★ 9,443TypeScriptupdated 2026-04-20agentagentic-ragai-codingclaude-codecode-generation
Background coding agent and real-time web interface
★ 1,456TypeScriptupdated 2026-03-19
ByteRover CLI (brv) - The portable memory layer for autonomous coding agents (formerly Cipher)
★ 4,645TypeScriptupdated 2026-04-20agentaiautonomous-agentsclicoding-assistant
Rules and Knowledge to work better with agents such as Claude Code or Cursor
★ 5,674Shellupdated 2025-12-31agentclaudecodecursorllmsrules
Claude Code dashboard with usage stats, error analysis, and sharable feature
★ 1,220Pythonupdated 2025-08-08agentaianalyticscoding
Open source AI coding agent. Designed for large projects and real world tasks.
★ 15,293Goupdated 2025-10-03aiai-agentsai-developer-toolsai-toolscli
A powerful GUI app and Toolkit for Claude Code - Create custom agents, manage interactive Claude Code sessions, run secure background agents, and more.
★ 21,657TypeScriptupdated 2025-10-16anthropicanthropic-claudeclaudeclaude-4claude-4-opus
Customizable and privacy-conscious open-source keyboard
★ 5,093Javaupdated 2026-04-19
Layouts for FUTO Keyboard
★ 80updated 2026-04-06
Various Dockerfiles I use on the desktop and on servers.
★ 13,944Dockerfileupdated 2024-07-06bashcontainersdockerdockerfiledockerfiles
InvenTree Label printing plugin for Niimbot label printers (b1, b18, b21, d11, d110)
★ 6Pythonupdated 2025-12-01inventreeinventreeplugins
🖨 NIIMBOT custom web client/app. Design and print labels with NIIMBOT printers directly from your PC or mobile web browser!
★ 590TypeScriptupdated 2026-04-13alternative-clientandroidcapacitorcustom-appfirmware-update
NiimPrintX is a Python library designed to seamlessly interface with NiimBot label printers via Bluetooth. This library supports a range of models including D11/B21/B1, D110, and B18.
★ 448Pythonupdated 2024-08-04niimbotpython3tkinter
Open-source developer platform to power your entire infra and turn scripts into webhooks, workflows and UIs. Fastest workflow engine (13x vs Airflow). Open-source alternative to Retool and Temporal.
★ 16,327HTMLupdated 2026-04-20low-codeopen-sourceplatformpostgresqlpython
Build an email assistant with human-in-the-loop and memory
★ 1,748Jupyter Notebookupdated 2025-10-20agentsmemory
DeepResearchAgent is a hierarchical multi-agent system designed not only for deep research tasks but also for general-purpose task solving. The framework leverages a top-level planning agent to coordinate multiple specialized lower-level agents, enabling automated task decomposition and efficient execution across diverse and complex domains.
★ 3,356Pythonupdated 2026-03-10gaiageneral-purposemultiagent-systemsmultimodel
An open-source, no-code agent building platform.
★ 1,860TypeScriptupdated 2026-02-25
The agentic video editing framework
★ 244Pythonupdated 2025-02-10
An orchestrated sub agent dev team powered by claude code
★ 4,191updated 2025-10-30
[EMNLP-2024] Build multimodal language agents for fast prototype and production
★ 2,640Pythonupdated 2025-03-19agentchatbotgeminigptgpt4
Trae Agent is an LLM-based agent for general purpose software engineering tasks.
★ 11,403Pythonupdated 2026-02-05agentllmsoftware-engineering
The agent that generates working apps (and maybe some other things)
★ 751Pythonupdated 2026-04-16
A free & open tool for transcribing audio interviews
★ 1,192JavaScriptupdated 2026-04-16
Automation of Whisper fine tuning using ClearML
★ 1Pythonupdated 2025-09-09clearmlclearml-servermlopsnlps3-storage
Fine-tune and evaluate Whisper models for Automatic Speech Recognition (ASR) on custom datasets or datasets from huggingface.
★ 361Pythonupdated 2023-05-23asrjaxpytorchspeech-recognitiontransformers
A framework helps you quickly build AI Native IDE products. MCP Client, supports Model Context Protocol (MCP) tools via MCP server.
★ 3,628TypeScriptupdated 2026-04-16aiai-firstai-nativeeditorelectron
A Go implementation of the Model Context Protocol (MCP), enabling seamless integration between LLM applications and external data sources and tools.
★ 8,634Goupdated 2026-04-20
Build agents that scale with a zero-cost abstraction.
★ 564TypeScriptupdated 2025-07-29agentic-aiaibunllmno-frameworks
Production-Ready MCP Server Framework • Build, deploy & scale secure AI agent infrastructure • Includes Auth, Observability, Debugger, Telemetry & Runtime • Run real-world MCPs powering AI Agents
★ 819Pythonupdated 2026-01-31agent-runtimeaiai-agentai-agent-toolsai-agents
53AI Hub is an open-source AI portal, which enables you to quickly build a operational-level AI portal to launch and operate AI agents, prompts, and AI tools. It supports seamless integration with development platforms like Coze, Dify, FastGPT, RAGFlow.
★ 5,681Goupdated 2026-03-04cozedifyfastgptgomaxkb
Build, test and manage your AI Agents in the central place.
★ 149Svelteupdated 2026-04-17agentaibotsharpchatbot
The PHP Agentic Framework to build production-ready AI driven applications. Connect components (LLMs, vector DBs, memory) to agents that can interact with your data.
★ 1,870PHPupdated 2026-04-20agentagentic-aiagentic-frameworkagentsai
✨ Build a machine learning model from a prompt
★ 2,564Pythonupdated 2026-03-06agentic-aiagentsaimachine-learningml
AI-native SaaS framework that builds full-stack apps using autonomous AI agents
★ 214Pythonupdated 2025-07-29ai-agentai-frameworkclaudecode-generationcodegen
The first AI agent that builds permissionless integrations through reverse engineering platforms' internal APIs.
★ 4,575Pythonupdated 2026-04-15agentagentsai-agentai-agentsapi
Examples and tutorials to help developers build AI systems
★ 3,963Pythonupdated 2026-03-05agentsaianthropicllmopenai
Trigger.dev – build and deploy fully‑managed AI agents and workflows
★ 14,678TypeScriptupdated 2026-04-19aiai-agent-frameworkai-agentsautomationbackground-jobs
Vagrant is a tool for building and distributing development environments.
★ 27,121Rubyupdated 2026-04-20automationrubyvagrantvirtualization
Python based web automation tool. Powerful and elegant.
★ 11,830Pythonupdated 2026-01-20automation-frameworkpythonweb-automation
Training Course for Ansible Automation Platform
★ 1,853Jinjaupdated 2026-04-16ansibleciscocisco-iosjuniper-networksnetworking
:house_with_garden: Open source home automation that puts local control and privacy first.
★ 86,247Pythonupdated 2026-04-20asynciohacktoberfesthome-automationinternet-of-thingsiot
Generic automation framework for acceptance testing and RPA
★ 11,600Pythonupdated 2026-04-20attdautomationbddpythonrobotframework
Repo for creating awesome automation scripts to make my panda lazier
★ 1,226Pythonupdated 2025-08-09hacktoberfesthacktoberfest-acceptedhacktoberfest2024hacktoberfest2024-acceptedpython
Free open source home automation system for Linux, Windows, Raspberry Pi. Supports Z-Wave, Zigbee, MQTT, and 150+ devices.
★ 3,738C++updated 2026-04-20cppdomoticzdzventsenergy-monitoringhome-automation
Mautic: Open Source Marketing Automation Software.
★ 9,505PHPupdated 2026-04-20digital-experience-platformdigitalexperienceplatformdxpemail-marketingemail-marketing-automation
Server automation framework and application
★ 7,842Rubyupdated 2026-03-16
Test Automation Made Simple
★ 8,843Javaupdated 2026-04-20api-testingassertionsautomated-testingautomationbdd
Adaptable, fast automation for all
★ 18,517Groovyupdated 2026-04-20build-toolgood-first-issuegradlegradle-btgroovy
A browser automation framework and ecosystem.
★ 34,062Javaupdated 2026-04-20dotnetjavajavascriptpythonruby
Google IT Automation with Python Professional Certificate - Practice files
★ 1,004Pythonupdated 2024-08-21
Automation with Python (Excel, scripts, etc)
★ 1,066Jupyter Notebookupdated 2024-05-19
Repair invalid JSON documents
★ 2,309TypeScriptupdated 2026-04-16jsonrepair
Raspberry Pi NVR for home CCTV recording.
★ 335Dockerfileupdated 2026-02-18
A raspberrypi distro to display a full page browser on boot
★ 4,372Shellupdated 2026-04-14
Ultimate Hacking Keyboard configurator
★ 770TypeScriptupdated 2026-04-20
The Unity Machine Learning Agents Toolkit (ML-Agents) is an open-source project that enables games and simulations to serve as environments for training intelligent agents using deep reinforcement learning and imitation learning.
★ 19,355C#updated 2026-04-17deep-learningdeep-reinforcement-learningmachine-learningneural-networksreinforcement-learning
★ 280updated 2026-03-06
A simple yet powerful agent framework that delivers with open-source models
★ 4,523Pythonupdated 2026-03-21agent-frameworkagentsopenai-agentspython
Simultaneous speech-to-text models
★ 10,187Pythonupdated 2026-03-31
Catalog of official Microsoft MCP (Model Context Protocol) server implementations for AI-powered data access and tool integration
★ 3,046C#updated 2026-04-17
A web frontend for the motion daemon.
★ 4,579Pythonupdated 2026-04-19cameramotion-detectionpythonpython3raspberrypi
Source repository for the DietPi OS documentation
★ 230HTMLupdated 2026-04-19dietpimkdocs
Computer vision based ML training data generation tool :rocket:
★ 608JavaScriptupdated 2025-02-15aiannotationannotation-toolcococomputer-vision
🔧 A curated list of awesome dataset tools
★ 935updated 2023-06-09annotation-toolannotationsawsomeawsome-listdatasets
Xtreme1 is an all-in-one data labeling and annotation platform for multimodal data training and supports 3D LiDAR point cloud, image, and LLM.
★ 1,185TypeScriptupdated 2025-07-153d-annotationannotationannotation-toolcomputer-visionimage-annotation
Collaborate & label any type of data, images, text, or documents, in an easy web interface or desktop app.
★ 2,060JavaScriptupdated 2025-03-15annotate-imagesannotation-toolclassificationcomputer-visioncsv
Visual Object Tagging Tool: An electron app for building end to end Object Detection Models from Images and Videos.
★ 4,430TypeScriptupdated 2021-12-06annotation-toolcntkdeep-learningdetectiondetection-model
A curated list of awesome data labeling tools
★ 4,314updated 2024-06-173d-annotationannotationannotation-toolaudio-annotationaudio-annotation-tool
Open source annotation tool for machine learning practitioners.
★ 10,635Pythonupdated 2026-04-14annotation-tooldata-labelingdatasetdatasetsmachine-learning
Argilla is a collaboration tool for AI engineers and domain experts to build high-quality datasets
★ 4,945Pythonupdated 2026-04-13active-learningaiannotation-tooldeveloper-toolsgpt-4
Export and convert Google Keep notes dynamically to markdown for Obsidian, Apple Notes, Logseq, Joplin and Notion using the unofficial Keep API. Also, import simple markdown notes back into Google Keep.
★ 672Pythonupdated 2026-03-23apple-notesapplenotesexport-keepgoogle-keepgooglekeep
Import markdown files to Notion.
★ 15Pythonupdated 2022-08-30
An enhancer/customiser for the all-in-one productivity workspace Notion
★ 5,013JavaScriptupdated 2026-02-28chromechrome-extensionedgeedge-extensionenhancer
Fast and accurate React renderer for Notion. TS batteries included. ⚡️
★ 5,408TypeScriptupdated 2026-03-30nextjsnotionnotion-apireactreact-notion
Official Notion JavaScript Client
★ 5,589TypeScriptupdated 2026-04-17apiapi-clientjavascriptjsnotion
Human Protocol python/js/ts Monorepo with example
★ 34TypeScriptupdated 2026-04-18
Open source audio annotation tool for humans
★ 1,133TypeScriptupdated 2026-02-03annotation-toolaudio-annotationaudio-processingdatasetsmachine-learning
Open source website builder and Webflow alternative. Webstudio is an advanced visual builder that connects to any headless CMS, supports all CSS properties, and can be hosted anywhere, including with us.
★ 8,469TypeScriptupdated 2026-04-20accessibilityalternativecloudflarecloudflare-workersdesign
Agent File (.af): An open file format for serializing stateful AI agents with persistent memory and behavior. Share, checkpoint, and version control agents across compatible frameworks.
★ 1,140TypeScriptupdated 2026-03-24
Magicrew. The first open-source all-in-one AI productivity platform (Generalist AI Agent + Workflow Engine + IM + Online collaborative office system)
★ 4,783TypeScriptupdated 2026-04-01agentagiaigptllm
🧠 Curated collection of system prompts for top AI tools. Perfect for AI agent builders and prompt engineers. Incuding: ChatGPT, Claude, Perplexity, Manus, Claude-Code, Loveable, v0, Grok, same new, windsurf, notion, and MetaAI.
★ 5,786TypeScriptupdated 2026-02-20
Tinyflow is a lightweight AI agent solution.
★ 657Svelteupdated 2026-04-13
Open-source, vision-first browser agent
★ 4,026TypeScriptupdated 2026-02-08aiautomationbrowserframeworkjavascipt
Build and run AI agents using Docker Compose. A collection of ready-to-use examples for orchestrating open-source LLMs, tools, and agent runtimes.
★ 929TypeScriptupdated 2026-04-20agentic-workflowsai-agentsdockerdocker-composeexamples
Open-source AI agent for web automation and scraping.
★ 401Pythonupdated 2025-02-01
The most powerful AI agent and AI chat software on Android/Operit是一款Android上能力最为强大的AI Agent
★ 4,249Kotlinupdated 2026-04-20agentaiandroidcomposekotlin
Agent-MCP is a framework for creating multi-agent systems that enables coordinated, efficient AI collaboration through the Model Context Protocol (MCP). The system is designed for developers building AI applications that benefit from multiple specialized agents working in parallel on different aspects of a project.
★ 1,228TypeScriptupdated 2026-03-28
The NVIDIA NeMo Agent toolkit is an open-source library for efficiently connecting and optimizing teams of AI agents.
★ 2,225Pythonupdated 2026-04-20
🚀 EvoAgentX: Building a Self-Evolving Ecosystem of AI Agents
★ 2,897Pythonupdated 2026-04-17agentaiai-agentsllmsmemory
Give Cursor Agent an AI Team and Advanced Skills
★ 4,762TypeScriptupdated 2025-08-25
Next-generation AI Agent Optimization Platform: Cozeloop addresses challenges in AI agent development by providing full-lifecycle management capabilities from development, debugging, and evaluation to monitoring.
★ 5,427Goupdated 2026-04-20agentagent-evaluationagent-observabilityagentopsai
Agent OS is a system for injecting your codebase standards and writing better specs for spec-driven development.
★ 4,377Shellupdated 2026-01-20
A collection of projects showcasing RAG, agents, workflows, and other AI use cases
★ 10,258Pythonupdated 2026-04-20agentsaihacktoberfestllmmcp
Glamourous agentic coding for all 💘
★ 23,501Goupdated 2026-04-20agentic-aiaillmsravishing
Get 10X more out of Claude Code, Codex or any coding agent
★ 25,545Rustupdated 2026-04-18agentai-agentskanbanmanagementtask-manager
Open-source infrastructure for Computer-Use Agents. Sandboxes, SDKs, and benchmarks to train and evaluate AI agents that can control full desktops (macOS, Linux, Windows).
★ 14,184HTMLupdated 2026-04-20agentai-agentapplecomputer-usecomputer-use-agent
Build Anything with AI Agents
★ 1,624TypeScriptupdated 2026-03-17agentic-aiagentic-frameworkai-agentsllmnatural-language-inference
A simple task management system for managing AI dev agents
★ 7,685updated 2025-11-05
A comprehensive development environment with specialized AI agents for code review, security analysis, and technical leadership.
★ 535Shellupdated 2026-04-19claude
⚡ Stream browser logs to terminal, zero setup, perfect for Ai Agents
★ 316TypeScriptupdated 2026-02-04aibrowserclaude-codecodex-clicursor
A minimal, end‑to‑end deep‑research agent implemented with AI SDK and Next.js
★ 113TypeScriptupdated 2025-08-18ai-chatbotai-sdkaisdkdeep-researchnextjs
🏆 Top-1 on 5+ benchmarks | Web UI | Supports MiroThinker, Claude, Kimi, OpenAI
★ 2,938Pythonupdated 2026-04-09agent-frameworkagentsbrowsecompclaudedeep-research
AI agents can now use real Android and iOS apps, just like a human.
★ 2,475Pythonupdated 2026-03-23agentsaibrowser-uselangchainlanggraph
ARGO is an open-source AI Agent platform that brings Local Manus to your desktop. With one-click model downloads, seamless closed LLM integration, and offline-first RAG knowledge bases, ARGO becomes a DeepResearch powerhouse for autonomous thinking, task planning, and 100% of your data stays locally. Support Win/Mac/Docker.
★ 676Pythonupdated 2026-01-06agentagentic-aiaiaigcanthropic
Open-Source Frontier Voice AI
★ 41,355Pythonupdated 2026-04-18
a magical LLM desktop client that makes it easy for *anyone* to use LLMs and MCP
★ 611Svelteupdated 2025-10-20geminillmllm-clientllmslocal-llm
A GUI tool for offline transcription of speech recordings, including speaker diarization, utilizing state-of-the-art machine learning models.
★ 1,113Pythonupdated 2026-04-16
Self-hosted AI audio transcription
★ 2,605Goupdated 2026-03-22aiaudiotranscripttranscription
Real-time speech recognition & AI-powered note-taking app for macOS with offline/online modes, multilingual transcription, and Japanese translation support.
★ 75TypeScriptupdated 2026-02-03macosmcpmcp-clientopenaiscreenshot
WhisperVoice: Covert voice notes. Encrypts text and hides it via LLM-generated acrostic sentences. Murf.ai creates natural audio. Browser extension decrypts with passcode, revealing hidden message or playing decoy for unauthorized listeners. Uses LLM, Murf.ai, STT APIs
★ 4JavaScriptupdated 2025-06-29murf-aimurf-ai-hackathon
A modern, lightweight note-taking app powered by Whisper
★ 5Rustupdated 2025-05-06aiwhisperwhisper-ai
A cross-platform desktop application that records audio and transcribes it to text using OpenAI's Whisper API or compatible services. Perfect for dictation, note-taking, and accessibility.
★ 27C#updated 2026-03-21
Node.js app that transcribes WhatsApp voice notes to text using OpenAI's Whisper API. The text can also be translated to the user's preferred language and sent back to their WhatsApp account.
★ 13HTMLupdated 2026-04-17
Transform your voice into text effortlessly with Whisper Notes
★ 9Rustupdated 2025-02-16
Ergonomic keyboards and mice, programming by voice, RSI, and standing desks.
★ 300updated 2023-01-05
Record voice notes & transcribe, summarize, and get tasks
★ 2,126TypeScriptupdated 2026-02-27
★ 1TypeScriptupdated 2025-11-27
Offline inference engine for art, real-time voice conversations, LLM powered chatbots and automated workflows
★ 1,314Pythonupdated 2026-02-10aiai-artartasset-generatorchatbot
An AI-Powered Speech Processing Toolkit and Open Source SOTA Pretrained Models, Supporting Speech Enhancement, Separation, and Target Speaker Extraction, etc.
★ 4,098Pythonupdated 2025-08-14audiobandwidth-extensiondeep-learningnoise-suppressionpytorch
End-to-end realtime stack for connecting humans and AI
★ 18,378Goupdated 2026-04-20golangmedia-serversfuvideovoice
Unofficial PyTorch implementation of Google AI's VoiceFilter system
★ 1,201Pythonupdated 2024-07-25audio-separationpytorchsource-separationspeech-separationvoicefilter
Near-Realtime audio transcription using self-hosted Whisper and WebSocket in Python/JS
★ 957Pythonupdated 2024-10-02aispeech-recognitionspeech-to-textwebsocket
Have a natural, spoken conversation with AI!
★ 3,626Pythonupdated 2025-07-11
An interactive AI voice agent that can capture and transcribe speech in real-time, generate intelligent responses using the DeepSeek R1 (7B model) AI, and convert the responses back to natural speech for immediate playback. The agent maintains conversation context and supports cross-platform usage on macOS, Linux, and Windows.
★ 20Pythonupdated 2025-06-20assemblyaideepseekdeepseek-r1elevenlabsportaudio
VoxNovel: generate audiobooks giving each character a different voice actor.
★ 360Pythonupdated 2025-06-08audiobook-creatoraudiobooksbooknlpepubgenerative-ai
Open Voice Operating System - Buildroot edition is a minimalistic linux OS bringing the OVOS voice assistant to embbeded, low-spec headless and/or small (touch)screen devices.
★ 279Pythonupdated 2025-12-19aiartificial-intelligencebuildroothacktoberfestlinux
Linux Voice Assistant for to Make Your Work Easier
★ 37Pythonupdated 2020-01-30assistantassistant-chat-botsgooglegoogle-assistantgoogle-assistant-apps
Desktop version of Whisper API called program, meant for quick, decent ASR for Linux and Windows.
★ 1Rustupdated 2025-08-26
Transcribe text using whisper.cpp on linux with a key combo & auto-type it
★ 1updated 2025-06-01
Simple Python Tkinter GUI App for linux that uses whisper from openai for transcription.
★ 3Pythonupdated 2023-06-22
Sample implementation to whisperai for Linux with real time transcription
★ 1Pythonupdated 2026-04-14
A Linux utility that provides system-wide speech-to-text functionality by connecting to a remote Whisper API server.
★ 1Shellupdated 2025-06-04
Press F9. Speak. Paste. A blazing-fast, offline voice transcription tool for Linux using Whisper.cpp, bound to a global hotkey.
★ 4Shellupdated 2025-06-24clipboardlinuxspeech-to-textubuntuvoice-to-text
Speech-to-Text/Code using a fast local LLM, for Linux, uses Whisper
★ 4Pythonupdated 2025-11-15linuxttswhisperwhisper-ai
A powerful, real-time dictation system for Linux
★ 6Pythonupdated 2025-06-22dictationlinuxspeech-to-textwhisper
Transcribe audio/video to text, locally on macOS, Linux and Windows. A simple whisper.cpp wrapper/UI built with Go/Fyne.
★ 17Goupdated 2026-01-08ffmpegffmpeg-wrapperfyneguilocal
This is my custom scripts to use Whisper / OpenAI by keyboard shortcuts and voice input.
★ 11Pythonupdated 2023-10-29
Fast, accurate voice typing for Linux — IBus input method engine with streaming STT, Whisper refinement, and CUDA acceleration
★ 10Pythonupdated 2026-02-10accessibilityfaster-whisperlinuxnixosspeech-to-text
expands the boundaries of speech recognition technology for documentation productivity on the Linux PC. With dictation and transcription capabilities as well as control over your system written in Python using whisper.
★ 14Pythonupdated 2025-08-12
Instantly generate AI-powered subtitles on your device. Works standalone or connects to DaVinci Resolve.
★ 3,269TypeScriptupdated 2026-04-19aidavincidavinci-resolvediarizelinux
Like ChatGPT's voice conversations with an AI, but entirely offline/private/trade-secret-friendly, using local AI models such as LLama 2 and Whisper
★ 161Pythonupdated 2024-08-20ai-assistantai-assistantsandroiddesktopkoboldai
A very simple whsper Python FastAPI for OpenAI API, Android voice-typing (konele), Home Assistant (wyoming), and a voice-typing script on Linux and MacOS!
★ 74Pythonupdated 2025-12-28fastapikoneleopenaiwhisper
Packages whisper.cpp into pre-built, pip-installable wheels, for macOS and Linux.
★ 178Pythonupdated 2024-06-10
A real-time, offline voice assistant for Linux and Raspberry Pi. Uses local LLMs (via Ollama), speech-to-text (Vosk), and text-to-speech (Piper) for fast, wake-free voice interaction. No cloud. No APIs. Just Python, a mic, and your voice.
★ 37Pythonupdated 2026-04-20androidchatbotdeep-learningechoesp-idf
Linux virtual keyboard driver which types what you say using Deepgram Flux STT API
★ 13Rustupdated 2026-02-03
Super STT enables effortless voice-to-text in any application, using the most advanced speech models.
★ 54Rustupdated 2026-04-14cosmiccosmic-desktoplinuxspeech-recognitionspeech-to-text
A local, real-time speech-to-text (STT) input tool for Linux, powered by RealtimeSTT and Faster-Whisper. Press a hotkey to dictate directly into any application.
★ 3Pythonupdated 2025-08-23
Use Home Assistant Assist on the desktop. Compatible with Windows, MacOS, and Linux
★ 132Svelteupdated 2026-01-15assistcross-platformdesktophome-assistanthome-assistant-assist
Speech to text for linux using whisper
★ 2Pythonupdated 2025-05-17
A scalable generative AI framework built for researchers and developers working on Large Language Models, Multimodal, and Speech AI (Automatic Speech Recognition and Text-to-Speech)
★ 17,126Pythonupdated 2026-04-20asrdeeplearninggenerative-aimachine-translationneural-networks
Easy-to-use Speech Toolkit including Self-Supervised Learning model, SOTA/Streaming ASR with punctuation, Streaming TTS with text frontend, Speaker Verification System, End-to-End Speech Translation and Keyword Spotting. Won NAACL2022 Best Demo Award.
★ 12,594Pythonupdated 2026-04-15asrcode-switchconformerkwspunctuation-restoration
TTS with kokoro and onnx runtime
★ 2,500Pythonupdated 2026-01-30kokoroonnxruntimepythontts
Towards Human-Sounding Speech
★ 6,108Pythonupdated 2025-12-05llmrealtimetts
Use Microsoft Edge's online text-to-speech service from Python WITHOUT needing Microsoft Edge or Windows or an API key
★ 10,696Pythonupdated 2026-03-22speech-synthesistext-to-speechtts
SoTA open-source TTS
★ 24,474Pythonupdated 2026-03-26
Gradio WebUI for creators and developers, featuring key TTS (Edge-TTS, kokoro) and zero-shot Voice Cloning (E2 & F5-TTS, CosyVoice), with Whisper audio processing, YouTube download, Demucs vocal isolation, and multilingual translation.
★ 6,708Pythonupdated 2025-12-05audiobookfaster-whispergradiokaraokepodcasts
Clone a voice in 5 seconds to generate arbitrary speech in real-time
★ 59,641Pythonupdated 2026-03-09deep-learningpythonpytorchtensorflowtts
⚙️ A Model Context Protocol (MCP) server for accessing Amazon S3 buckets. This server provides seamless integration with S3 storage through MCP, allowing efficient handling of large files including PDFs through streaming capabilities.
★ 5TypeScriptupdated 2025-07-06
Visual intelligence for your home.
★ 1,305Pythonupdated 2026-03-23aicctv-detectionhacs-integrationhome-assistantllm
Use Claude Code as the foundation for coding infrastructure, allowing you to decide how to interact with the model while enjoying updates from Anthropic.
★ 32,959TypeScriptupdated 2026-03-04
GoCD - Continuous Delivery server main repository
★ 7,390Javaupdated 2026-04-18cdcici-cdcontinuous-deliverycontinuous-delivery-server
webhook is a lightweight incoming webhook server to run shell commands
★ 11,770Goupdated 2026-02-12automateautomationcideploydevops
The Microsoft 365 Agent SDK simplifies building full stack, multichannel, trusted agents for platforms including M365, Teams, Copilot Studio, and Webchat.
★ 864PowerShellupdated 2026-04-16agentsbotbotframeworkcopilotcopilotstudio
SOTA Open Source TTS
★ 29,936Pythonupdated 2026-04-06llamatransformerttsvallevits
The Monorepo Platform that amplifies both developers and AI agents. Nx optimizes your builds, scales your CI, and fixes failed PRs automatically. Ship in half the time.
★ 28,600TypeScriptupdated 2026-04-20angularbuildbuild-systembuild-toolbuilding-tool
MCP server that enables AI agents to analyze projects, initialize vibe unified rules for AI coding across Claude Code, Cursor, GitHub Copilot, and Gemini CLI
★ 21TypeScriptupdated 2026-03-12
An AI Gateway, registry, and proxy that sits in front of any MCP, A2A, or REST/gRPC APIs, exposing a unified endpoint with centralized discovery, guardrails and management. Optimizes Agent & Tool calling, and supports plugins.
★ 3,616Pythonupdated 2026-04-20agentsaiapi-gatewayasyncioauthentication-middleware
Connect APIs, remarkably fast. Free for developers.
★ 11,280JavaScriptupdated 2026-04-20apisautomationbashclidata-flow
Qwen3-VL is the multimodal large language model series developed by Qwen team, Alibaba Cloud.
★ 19,051Jupyter Notebookupdated 2026-01-30
Qwen3-Coder is the code version of Qwen3, the large language model series developed by Qwen team.
★ 16,442Pythonupdated 2026-03-24
A Lightweight Face Recognition and Facial Attribute Analysis (Age, Gender, Emotion and Race) Library for Python
★ 22,628Pythonupdated 2026-03-01age-predictionarcfacedeep-learningdeepfacedeepid
Pretrained Pytorch face detection (MTCNN) and facial recognition (InceptionResnet) models
★ 5,144Pythonupdated 2025-09-16face-detectionface-identificationface-recognitionface-trackingfacial-recognition
A modern FastAPI-based web app for real-time object detection using YOLO models, supporting image and video uploads, model selection, live streaming, and interactive UI.
★ 9Pythonupdated 2025-06-28ai-projectback-endcomputer-visionfastapifront-end
Awesome Object Detection based on handong1587 github: https://handong1587.github.io/deep_learning/2015/10/09/object-detection.html
★ 7,501updated 2022-12-17computer-visiondeep-learningdetectionobject-detectionobject-localisation
installation for nvidia with cuda and ffmpeg encode on video card on Ubuntu 22.04 with GeForce GTX 1050 Ti
★ 3Shellupdated 2022-08-19
Tapo Camera ONVIF Motion detection with ONVIF messages , RTSP stream capture and AI Object Detection
★ 38Pythonupdated 2024-04-06
FFmpeg compiled inside an NVIDIA-enabled Docker Container
★ 62Dockerfileupdated 2025-12-02
A concise guide for using Google's Agent Development Kit (ADK) to build various AI applications.
★ 1Pythonupdated 2025-08-09adkadk-pythonagentic-aiagentsgoogle
This repository provides a curated collection of practical examples showcasing a variety of agent design patterns and applications. It includes hands-on demonstrations for building and orchestrating multi-agent systems using leading frameworks such as Google’s Agent Development Kit (ADK), LangGraph, CrewAI, AutoGen and others.
★ 8Pythonupdated 2025-11-20
PolisMind is a Python-based multi-agent civic policy auditor and simulator. It provides socioeconomic insights and compliance reports by analyzing, simulating, and optimizing public policies using LangChain, Google Cloud (Vertex AI, BigQuery), and custom AI agents.
★ 1Pythonupdated 2025-06-06
Official repository for the Udemy course "Master Google ADK: Build Enterprise Multi-Agent AI Systems". Includes hands-on Jupyter notebooks, setup guides, and agent design patterns using Google’s Agent Development Kit (ADK).
★ 9Jupyter Notebookupdated 2025-06-21
A curated list of awesome resources for Google's Agent Development Kit (ADK)
★ 75updated 2025-05-05agent-development-kitai-agentsartificial-intelligenceawesome-listgoogle-adk
The best way to create, deploy, and share MCP Servers
★ 868Pythonupdated 2026-04-19aiai-gatewayarcadearcade-aillm-tool-call
Agent Development Kit Web (adk web) is the built-in developer UI that is integrated with Agent Development Kit for easier agent development and debugging.
★ 926TypeScriptupdated 2026-04-10
An open-source, code-first Java toolkit for building, evaluating, and deploying sophisticated AI agents with flexibility and control.
★ 1,510Javaupdated 2026-04-18agentagenticagentic-aiagentic-workflowagents
An open-source, code-first toolkit for building, evaluating, and deploying sophisticated AI agents with flexibility and control.
★ 1,315Shellupdated 2026-04-17
Agentic ADK is an Agent application development framework launched by Alibaba International AI Business, based on Google-ADK and Ali-LangEngine.
★ 667Javaupdated 2025-11-24
FOSS Tapo C210
★ 70updated 2024-09-14fosstapotapo-device
★ 2updated 2025-04-02
Tp Link Tapo C210 RTSP Stream + YOLOv8 + Flask
★ 2Pythonupdated 2025-01-30
Unofficial CLI app for remoting model cameras TP Link Tapo (C200, C210, C220, C310 ...)
★ 70Goupdated 2023-12-20c200c210c220c310camera
WebGoat is a deliberately insecure application
★ 9,092JavaScriptupdated 2026-02-08
A fast, modern download manager for HTTP, BitTorrent, Magnet, and ed2k. Cross-platform, built with Golang and Flutter.
★ 24,147Goupdated 2026-04-19androidbittorrentcross-platformdebiandownloader
Free and Open Source Machine Translation API. Self-hosted, offline capable and easy to setup.
★ 14,237Pythonupdated 2026-04-07apimachinetranslatetranslationtranslator
An open source, self-hosted implementation of the Tailscale control server
★ 37,774Goupdated 2026-04-19tailscaletailscale-control-servertailscale-serverwireguard
A feature-rich command-line audio/video downloader
★ 158,626Pythonupdated 2026-04-19clidownloaderpythonsponsorblockyoutube-dl
DeepSeek CLI, a command-line AI coding assistant that leverages the powerful DeepSeek Coder models
★ 191TypeScriptupdated 2025-08-25artificial-intelligenceclaudeclaude-aiclaude-codecursor
A powerful command-line interface for interacting with DeepSeek's AI models.
★ 65Pythonupdated 2026-03-29
Nuclino API wrapper for Python
★ 5Pythonupdated 2024-02-19
Collection of AI-related utilities. Welcome to submit pull requests /收藏AI相关的实用工具,欢迎提交pull requests
★ 5,856Pythonupdated 2026-04-20agent-skillsaiartificial-intelligenceawesomeawesome-list
A high-performance LLM inference API and Chat UI that integrates DeepSeek R1's CoT reasoning traces with Anthropic Claude models.
★ 5,361Rustupdated 2025-10-07aianthropicanthropic-claudeapichain-of-thought
YuE: Open Full-song Music Generation Foundation Model, something similar to Suno.ai but open
★ 6,167Pythonupdated 2025-06-04aiaudio-generationdeep-learningfoundation-modelsgpt
Adversarial Robustness Toolbox (ART) - Python Library for Machine Learning Security - Evasion, Poisoning, Extraction, Inference - Red and Blue Teams
★ 5,947Pythonupdated 2025-12-12adversarial-attacksadversarial-examplesadversarial-machine-learningaiartificial-intelligence
Adding guardrails to large language models.
★ 6,759Pythonupdated 2026-04-03aifoundation-modelgpt-3llmopenai
Aim 💫 — An easy-to-use & supercharged open-source experiment tracker.
★ 6,100Pythonupdated 2026-04-19aidata-sciencedata-visualizationexperiment-trackingmachine-learning
🤖 Awesome list for ChatGPT — an artificial intelligence chatbot developed by OpenAI
★ 6,215updated 2026-02-15aiartificial-intelligenceawesomeawesome-listchatgpt
Community-contributed instructions, agents, skills, and configurations to help you make the most of GitHub Copilot.
★ 31,229Pythonupdated 2026-04-20agent-skillsagentsaiawesomecustom-agents
Collection of Open Source Projects Related to GPT,GPT相关开源项目合集🚀、精选🔥🔥
★ 6,000Pythonupdated 2025-05-16agentgptaiaigcautogptawesome
Turn any webpage into structured data using LLMs
★ 6,351TypeScriptupdated 2026-04-13aiartificial-intelligencebrowserbrowser-automationgpt
David AI is a free and open-source collection of customizable, production-ready UI components built with Tailwind CSS.
★ 6,072HTMLupdated 2025-01-08aiai-frameworkangular-landing-pagedashboarddynamic-components
Flower: A Friendly Federated AI Framework
★ 6,854Pythonupdated 2026-04-19aiandroidartificial-intelligencecppdeep-learning
AI that sees your screen, listens to your conversations and tells you what to do
★ 12,196Dartupdated 2026-04-20aiappbcicflutter
SuperPrompt is an attempt to engineer prompts that might help us understand AI agents.
★ 6,405updated 2025-09-03aimlprompt-engineeringpromptsprompts-template
AI + Data, online. https://vespa.ai
★ 6,896Javaupdated 2026-04-20aibig-datajavamachine-learningrag
🕷️ An adaptive Web Scraping framework that handles everything from a single request to a full-scale crawl!
★ 38,714Pythonupdated 2026-04-18aiai-scrapingautomationcrawlercrawling
Multilingual Voice Understanding Model
★ 8,041Pythonupdated 2025-12-30aiaigcasraudio-event-classificationcross-lingual
WebChatGPT: A browser extension that augments your ChatGPT prompts with web results.
★ 6,457TypeScriptupdated 2024-08-13aibrowser-extensionchatgptchrome-extensionfirefox-addon
FlowGram is an extensible workflow development framework with built-in canvas, form, variable, and materials that helps developers build AI workflow platforms faster and simpler.
★ 7,968TypeScriptupdated 2026-04-16aiautomationcozedata-flowdiagram
This repo is meant to serve as a guide for Machine Learning/AI technical interviews.
★ 8,066Jupyter Notebookupdated 2025-11-28agenticaiai-agentsai-engineeringdeep-learning
A repository of models, textual inversions, and more
★ 7,089TypeScriptupdated 2026-04-18aisocial-networkstable-diffusion
A Smart, Automatic, Fast and Lightweight Web Scraper for Python
★ 7,146Pythonupdated 2025-06-09aiartificial-intelligenceautomationcrawlermachine-learning
Coroot is an open-source observability and APM tool with AI-powered Root Cause Analysis. It combines metrics, logs, traces, continuous profiling, and SLO-based alerting with predefined dashboards and inspections.
★ 7,578Goupdated 2026-04-20aialertingapmdashboarddatabase-monitoring
Privacy first, AI meeting assistant with 4x faster Parakeet/Whisper live transcription, speaker diarization, and Ollama summarization built on Rust. 100% local processing. no cloud required. Meetily (Meetly Ai - https://meetily.ai) is the #1 Self-hosted, Open-source Ai meeting note taker for macOS & Windows.
★ 11,335Rustupdated 2026-03-16aiai-meeting-assistantllmlocal-aimac
The most powerful Android RPA agent framework, next generation mobile automation.
★ 7,754Pythonupdated 2026-03-24adbagentsaiandroidappium
A curated list of awesome embedded programming.
★ 8,466updated 2026-03-18aiautosarawesomebeaglebonebootloader
✨ Build AI agents and web apps — with a single binary.
★ 7,535Goupdated 2026-04-19agentagentic-aiagentsaiai-applications
Background Remover lets you Remove Background from images and video using AI with a simple command line interface that is free and open source.
★ 7,852Pythonupdated 2026-03-21aibackground-removalbackground-removerbackgroundremoverphoto-editing
A research prototype of a human-centered web agent
★ 9,797Pythonupdated 2026-04-15agentsaiai-uxautogenbrowser-use
Sweep: AI coding assistant for JetBrains
★ 7,705Jupyter Notebookupdated 2025-09-18aiai-developerai-softwarai-softwarecode-assistant
Stable Diffusion built-in to Blender
★ 8,150Pythonupdated 2024-08-26aiblenderblender-addonimage-generationstable-diffusion
EmotiVoice 😊: a Multi-Voice and Prompt-Controlled TTS Engine
★ 8,470Pythonupdated 2024-08-13aideep-learningemotionemotivoicemulti-speaker
OpenVINO™ is an open source toolkit for optimizing and deploying AI inference
★ 10,142C++updated 2026-04-20aicomputer-visiondeep-learningdeploy-aidiffusion-models
Build, Manage and Deploy AI/ML Systems
★ 10,056Pythonupdated 2026-04-20agentsaiawsazurecost-optimization
Expose your FastAPI endpoints as Model Context Protocol (MCP) tools, with Auth!
★ 11,824Pythonupdated 2025-11-24aiauthenticationauthorizationclaudecursor
TensorZero is an open-source LLMOps platform that unifies an LLM gateway, observability, evaluation, optimization, and experimentation.
★ 11,278Rustupdated 2026-04-19aiai-engineeringanthropicartificial-intelligencedeep-learning
A powerful MCP toolkit for coding, providing semantic retrieval and editing capabilities - the IDE for your agent
★ 23,423Pythonupdated 2026-04-20agentaiai-codingclaudeclaude-code
Intelligent automation and multi-agent orchestration for Claude Code
★ 34,308Pythonupdated 2026-04-18agentsanthropicanthropic-claudeautomationclaude
AI-powered, vision-driven UI automation for every platform.
★ 12,804TypeScriptupdated 2026-04-20aiai-testbrowser-usecomputer-usegpt-operator
The AI developer platform. Use Weights & Biases to train and fine-tune models, and manage models from experimentation to production.
★ 11,031Pythonupdated 2026-04-20aicollaborationdata-sciencedata-versioningdeep-learning
💡 All-in-one AI framework for semantic search, LLM orchestration and language model workflows
★ 12,424Pythonupdated 2026-04-14agentsaiai-agentsembeddingsinformation-retrieval
A curated list of Artificial Intelligence (AI) courses, books, video lectures and papers.
★ 13,518updated 2025-08-12aiartificial-intelligencedeep-learningintelligent-machinesintelligent-systems
A 100% free modern JS SaaS boilerplate (React, NodeJS, Prisma). Full-featured: Auth (email, google, github, slack, MS), Email sending, Background jobs, Landing page, Payments (Stripe, Polar.sh), Shadcn UI, S3 file upload. AI-ready with tailored AGENTS.md, skills, and Claude Code plugin. One cmd deploy. Powered by Wasp full-stack framework.
★ 14,261TypeScriptupdated 2026-04-16aiauthenticationaws-s3boilerplatechatgpt
An open-source, code-first Python toolkit for building, evaluating, and deploying sophisticated AI agents with flexibility and control.
★ 19,274Pythonupdated 2026-04-20agentagenticagentic-aiagentsagents-sdk
20+ high-performance LLMs with recipes to pretrain, finetune and deploy at scale.
★ 13,326Pythonupdated 2026-04-16aiartificial-intelligencedeep-learninglarge-language-modelsllm
The simplest way to run LLaMA on your local machine
★ 12,953CSSupdated 2024-06-18aillamallm
A curated list of references for MLOps
★ 13,874updated 2024-11-21aidata-sciencedevopsengineeringfederated-learning
Free, simple, fast interactive diagrams for any GitHub repository
★ 15,493TypeScriptupdated 2026-04-13aicodegithubsystem-design
SWE-agent takes a GitHub issue and tries to automatically fix it, using your LM of choice. It can also be employed for offensive cybersecurity or competitive coding challenges. [NeurIPS 2024]
★ 19,059Pythonupdated 2026-04-13agentagent-based-modelaicybersecuritydeveloper-tools
Welcome to the Llama Cookbook! This is your go to guide for Building with Llama: Getting started with Inference, Fine-Tuning, RAG. We also show you how to solve end to end problems using Llama model family and using them on various provider services
★ 18,303Jupyter Notebookupdated 2026-04-17aifinetuninglangchainllamallama2
A TTS model capable of generating ultra-realistic dialogue in one pass.
★ 19,284Pythonupdated 2025-11-19aiopen-weighttext-to-speech
Go language library for reading and writing Microsoft Excel™ (XLAM / XLSM / XLSX / XLTM / XLTX) spreadsheets
★ 20,515Goupdated 2026-04-18agentaianalyticschartecma-376
daily.dev is a professional network for developers to learn, collaborate, and grow together 👩🏽‍💻 👨‍💻
★ 19,785updated 2026-03-10aichrome-extensioncommunitydeveloper-portaldeveloper-tools
🤗 The largest hub of ready-to-use datasets for AI models with fast, easy-to-use and efficient data manipulation tools
★ 21,453Pythonupdated 2026-04-17aiartificial-intelligencecomputer-visiondataset-hubdatasets
An AI-powered task-management system you can drop into Cursor, Lovable, Windsurf, Roo, and others.
★ 26,831JavaScriptupdated 2026-03-31aicursorcursor-aicursorailovable
Python scraper based on AI
★ 23,388Pythonupdated 2026-04-19ai-crawlerai-scrapingai-searchcrawlerdata-extraction
OpenUI let's you describe UI using your imagination, then see it rendered live.
★ 22,257TypeScriptupdated 2026-02-11aigenerative-aihtml-css-javascripttailwindcss
The open source AI engineering platform for agents, LLMs, and ML models. MLflow enables teams of all sizes to debug, evaluate, monitor, and optimize production-quality AI applications while controlling costs and managing access to models and data.
★ 25,566Pythonupdated 2026-04-20agentopsagentsaiai-governanceapache-spark
Learn OpenCV : C++ and Python Examples
★ 22,892Jupyter Notebookupdated 2026-04-16aicomputer-visioncomputervisiondeep-learningdeep-neural-networks
Industry leading face manipulation platform
★ 28,043Pythonupdated 2026-04-19aideep-fakedeepfakeface-swapfaceswap
Pretrain, finetune ANY AI model of ANY size on 1 or 10,000+ GPUs with zero code changes.
★ 31,080Pythonupdated 2026-04-20aiartificial-intelligencedata-sciencedeep-learningmachine-learning
Visualizer for neural network, deep learning and machine learning models
★ 32,805JavaScriptupdated 2026-04-20aicoremldeep-learningdeeplearningkeras
💫 Industrial-strength Natural Language Processing (NLP) in Python
★ 33,513Pythonupdated 2026-03-28aiartificial-intelligencecythondata-sciencedeep-learning
Making large AI models cheaper, faster and more accessible
★ 41,379Pythonupdated 2026-04-13aibig-modeldata-parallelismdeep-learningdistributed-computing
🦍 The API and AI Gateway
★ 43,260Luaupdated 2026-03-27aiai-gatewayapi-gatewayapi-managementapis
ClickHouse® is a real-time analytics database management system
★ 47,079C++updated 2026-04-20aianalyticsbig-dataclickhousecloud-native
Financial data platform for analysts, quants and AI agents.
★ 66,523Pythonupdated 2026-04-19aicryptoderivativeseconomicsequity
CLI platform to experiment with codegen. Precursor to: https://lovable.dev
★ 55,220Pythonupdated 2025-05-14aiautonomous-agentcode-generationcodebase-generationcodegen
Unified Efficient Fine-Tuning of 100+ LLMs & VLMs (ACL 2024)
★ 70,611Pythonupdated 2026-04-20agentaideepseekfine-tuninggemma
Implement a ChatGPT-like LLM in PyTorch from scratch, step by step
★ 91,441Jupyter Notebookupdated 2026-04-16aiartificial-intelligencechatbotchatgptdeep-learning
real time face swap and one-click video deepfake with only a single image
★ 92,306Pythonupdated 2026-04-19aiai-deep-fakeai-faceai-webcamartificial-intelligence
Master programming by recreating your favorite technologies from scratch.
★ 496,188Markdownupdated 2026-02-21awesome-listfreeprogrammingtutorial-codetutorial-exercises
List of projects that provide terminal user interfaces
★ 18,454updated 2026-04-15
Leantime is a goals focused project management system for non-project managers. Building with ADHD, Autism, and dyslexia in mind.
★ 9,545PHPupdated 2026-04-16agileasanacalendarclickupgantt
TF-Agents: A reliable, scalable and easy to use TensorFlow library for Contextual Bandits and Reinforcement Learning.
★ 3,007Pythonupdated 2026-01-16banditscontextual-banditsdqnmulti-armed-banditsreinforcement-learning
End-to-end, code-first tutorials for building production-grade GenAI agents. From prototype to enterprise deployment.
★ 18,915Jupyter Notebookupdated 2026-04-15agentagent-frameworkagentsai-agentsdeployment
An open and scalable video surveillance system for anyone making this world a better and more peaceful place.
★ 1,019Goupdated 2026-04-13dockergolangipcameramotiondetectionmotiondetector
sharing current agents in use
★ 12,354updated 2025-07-28
The Open-Source Multimodal AI Agent Stack: Connecting Cutting-Edge AI Models and Agent Infra
★ 29,520TypeScriptupdated 2026-03-27agentagent-tarsbrowser-usecomputer-usecowork
A collection of sample agents built with Agent Development Kit (ADK)
★ 8,981Pythonupdated 2026-04-20adkagent-samplesagents
Secure environments for developers and their agents
★ 13,015Goupdated 2026-04-20agentsdev-toolsdevelopment-environmentgogolang
II-Agent: a new open-source framework to build and deploy intelligent agents
★ 3,330Pythonupdated 2026-04-13agentagentic-aiaiai-agentai-agent-framework
The leading agentic finance toolkit for AI agents
★ 985TypeScriptupdated 2026-04-14agentsaiblockchaincrypto
The open source coding agent.
★ 149,611TypeScriptupdated 2026-04-20
Warp is an agentic development environment, born out of the terminal.
★ 26,507updated 2026-04-18bashlinuxmacosrustshell
An AI agent development platform with all-in-one visual tools, simplifying agent creation, debugging, and deployment like never before. Coze your way to AI Agent creation.
★ 20,627TypeScriptupdated 2026-04-20agentagent-platformai-pluginschatbotchatbot-framework
Mobile-Agent: The Powerful GUI Agent Family
★ 8,562Pythonupdated 2026-04-14agentandroidappautomationcopilot
A workshop that teaches you how to build your own coding agent. Similar to Roo code, Cline, Amp, Cursor, Windsurf or OpenCode.
★ 5,494Goupdated 2026-04-19agentaicursortutorialworkshop
An open-source AI agent that lives in your terminal.
★ 23,863TypeScriptupdated 2026-04-20
A user-friendly Raspberry Pi baby monitor with cry detection and audio/video streaming.
★ 52PHPupdated 2026-02-03
Ready-to-use SRT / WebRTC / RTSP / RTMP / LL-HLS / MPEG-TS / RTP media server and media proxy that allows to read, publish, proxy, record and playback video and audio streams.
★ 18,581Goupdated 2026-04-19gogolanghlsmedia-serverobs-studio
💖🧸 Self hosted, you-owned Grok Companion, a container of souls of waifu, cyber livings to bring them into our worlds, wishing to achieve Neuro-sama's altitude. Capable of realtime voice chat, Minecraft, Factorio playing. Web / macOS / Windows supported.
★ 38,631TypeScriptupdated 2026-04-18ai-companionai-vtuberairidigital-lifegrok-companion
Modified XL Lora trainer from https://colab.research.google.com/github/hollowstrawberry/kohya-colab/blob/main/Lora_Trainer_XL.ipynb
★ 8Jupyter Notebookupdated 2026-03-14
A library for easily merging multiple LLM experts, and efficiently train the merged LLM.
★ 511Pythonupdated 2024-08-26artificial-intelligencefine-tuninggenerative-ailarge-language-modelsllm
The stable diffusion webui training aid extension helps you quickly and visually train models such as Lora.
★ 423Pythonupdated 2024-03-28
Agent Reinforcement Trainer: train multi-step agents for real-world tasks using GRPO. Give your agents on-the-job training. Reinforcement learning for Qwen3.5, GPT-OSS, Llama, and more!
★ 9,244Pythonupdated 2026-04-18agentagentic-aigrpollmslora
The open source research environment for AI researchers to seamlessly train, evaluate, and scale models from local hardware to GPU clusters.
★ 4,934Pythonupdated 2026-04-19diffusiondiffusion-modelselectronllamallms
Qwen-Image text to image lora trainer
★ 739Pythonupdated 2025-12-16
This custom node lets you train LoRA directly in ComfyUI!
★ 540Pythonupdated 2024-08-05
A UI made in Pyside6 to make training LoRA/LoCon and other LoRA type models in sd-scripts easy
★ 1,303Pythonupdated 2025-06-05
SD-Trainer. LoRA & Dreambooth training scripts & GUI use kohya-ss's trainer, for diffusion model.
★ 6,015Pythonupdated 2025-09-08dreamboothfinetunelorastable-diffusion
OneTrainer is a one-stop solution for all your Diffusion training needs.
★ 2,945Pythonupdated 2026-04-13fine-tuningimage-model-trainingloratraining
An open-source AI agent that brings the power of Gemini directly into your terminal.
★ 102,414TypeScriptupdated 2026-04-20aiai-agentscligeminigemini-api
The fullstack MCP framework to develop MCP Apps for ChatGPT / Claude & MCP Servers for AI Agents.
★ 9,816TypeScriptupdated 2026-04-20agentic-frameworkaiapps-sdkchatgptclaude-code
CarrotAI is a cutting-edge AI agent application that delivers real-time streaming chat via Server-Sent Events (SSE) with built-in Model Control Protocol (MCP) integration. It supports concurrent connections to multiple SSE MCP servers and provides user interfaces in English, Chinese, and Japanese.
★ 83Dartupdated 2025-05-10
Home Assistant custom component for real-time viewing of almost any camera stream using WebRTC and other technologies.
★ 2,099JavaScriptupdated 2025-11-26hacshome-assistantip-cameramediasource-extensionsrtsp
Automate your mobile devices with natural language commands - an LLM agnostic mobile Agent 🤖
★ 8,216Pythonupdated 2026-04-17ai-agentsandroidandroid-automationhacktoberfestmobile-automation
Lightweight justice for your single-board computer!
★ 6,020Shellupdated 2026-04-20bashdebiandietpilightweightnanopi
Program that prepares ZFS on a system, and installs Linux
★ 185Shellupdated 2022-10-16bootdebianfilesystemshacktoberfestlinux
Simple Python version management
★ 44,668Shellupdated 2026-04-17pythonshell
Implementation of paper - YOLOv7: Trainable bag-of-freebies sets new state-of-the-art for real-time object detectors
★ 14,102Jupyter Notebookupdated 2024-08-19darknetpytorchscaled-yolov4yoloryolov3
Implementation of paper - YOLOv9: Learning What You Want to Learn Using Programmable Gradient Information
★ 9,526Pythonupdated 2024-08-09yolov9
The Hailo Model Zoo includes pre-trained models and a full building and evaluation environment
★ 634Pythonupdated 2026-04-05ai-acceleratorscomputer-visiondeep-learningedge-aihailo
A deep learning application that classifies the reason for a baby's cry (hunger, pain, etc.) from live or uploaded audio. Built with a TensorFlow/Keras CNN, Librosa for audio processing, and a responsive Flask web UI with real-time recording and visualization. Helps caregivers understand an infant's needs instantly.
★ 2updated 2025-08-01
Easily train or fine-tune SOTA computer vision models with one open source training library. The home of Yolo-NAS.
★ 5,025Jupyter Notebookupdated 2026-02-24dependency-graph
MCP server for creating UI flowcharts
★ 11TypeScriptupdated 2025-01-05
Backup Docker volumes locally or to any S3, WebDAV, Azure Blob Storage, Dropbox, Google Drive or SSH compatible storage
★ 3,524Goupdated 2026-04-14backupdockerdocker-composedocker-swarmdocker-volume
Python scripts performing object detection using the YOLOv8 model in ONNX.
★ 483Pythonupdated 2024-08-22computer-visiondeep-learningobject-detectiononnxonnxruntime
LLM API 管理 & 分发系统,支持 OpenAI、Azure、Anthropic Claude、Google Gemini、DeepSeek、字节豆包、ChatGLM、文心一言、讯飞星火、通义千问、360 智脑、腾讯混元等主流模型,统一 API 适配,可用于 key 管理与二次分发。单可执行文件,提供 Docker 镜像,一键部署,开箱即用。LLM API management & key redistribution system, unifying multiple providers under a single API. Single binary, Docker-ready, with an English UI.
★ 32,539JavaScriptupdated 2026-01-09apiapi-gatewayazure-openai-apichatgptclaude
Triton Inference Server Web UI
★ 20TypeScriptupdated 2023-11-06aitriton-inference-serveruser-interfaceweb
The Triton Inference Server provides an optimized cloud and edge inferencing solution.
★ 10,605Pythonupdated 2026-04-20clouddatacenterdeep-learningedgegpu
Ultralytics YOLO 🚀
★ 56,435Pythonupdated 2026-04-20clicomputer-visiondeep-learninghubimage-classification
A collection of pre-trained, state-of-the-art models in the ONNX format
★ 9,562Jupyter Notebookupdated 2026-03-09deep-learningdownloadmodelsonnxpretrained
Build and run containers leveraging NVIDIA GPUs
★ 4,283Goupdated 2026-04-18
Self-hosted, local only NVR and AI Computer Vision software. With features such as object detection, motion detection, face recognition and more, it gives you the power to keep an eye on your home,…
★ 2updated 2025-05-24
Modern NVR with object/motion/audio detection, push notifications, multi-location, and encrypted local and cloud-based storage support built in.
★ 4updated 2024-10-06aicamerahome-assistanthome-automationip-camera
A powerful Network Video Recorder (NVR) application that leverages GPU acceleration for real-time AI object detection, smart recording, and efficient video management. Built with Python, Flask, and YOLOv5, this application provides enterprise-grade surveillance capabilities with a user-friendly interface.
★ 1Pythonupdated 2026-04-08
A complete and local NVR designed for Home Assistant with AI object detection
★ 16updated 2026-04-20
Self-hosted, local only NVR and AI Computer Vision software. With features such as object detection, motion detection, face recognition and more, it gives you the power to keep an eye on your home, office or any other place you want to monitor.
★ 3,011Pythonupdated 2026-04-17coralcudadarknetedgetpuface-recognition
Open Source NVR
★ 92TypeScriptupdated 2026-03-12
A Model Context Protocol (MCP) server that enables AI assistants like Claude to interact with your Google Cloud Platform environment. This allows for natural language querying and management of your GCP resources during conversations.
★ 197TypeScriptupdated 2025-05-05
The Terraform MCP Server provides seamless integration with Terraform ecosystem, enabling advanced automation and interaction capabilities for Infrastructure as Code (IaC) development.
★ 1,339Goupdated 2026-04-17
Codemagic CI/CD MCP Server
★ 8Pythonupdated 2025-05-01
★ 55TypeScriptupdated 2024-12-02
DevOps AI Assistant benchmarks for AWS, Kubernetes, and more
★ 42Rubyupdated 2024-08-10awskubernetesterraform
A fully autonomous, AI-powered DevOps platform for managing cloud infrastructure across multiple providers, with AWS and GitHub integration, powered by OpenAI's Agents SDK.
★ 203Pythonupdated 2025-03-21
Simple tunneling reverse proxy with a fast web UI and auto HTTPS. Designed for self-hosters.
★ 1,371Goupdated 2024-07-06
A fast reverse proxy to help you expose a local server behind a NAT or firewall to the internet.
★ 106,097Goupdated 2026-04-13exposefirewallfrpgohttp-proxy
Identity-aware VPN and tunneled reverse proxy for remote access.
★ 20,426TypeScriptupdated 2026-04-20identity-managementiotnat-traversaloidcpam
Instance and Community Explorer for Lemmy
★ 145TypeScriptupdated 2026-02-02fediverselemmylemmyversembinnodejs
Sanity Studio – Rapidly configure content workspaces powered by structured content
★ 6,087TypeScriptupdated 2026-04-20cmsheadlessreactreactjsreal-time
Calculate prices for calling LLM inference APIs.
★ 282Pythonupdated 2026-04-17
Modular MCP server for OPNsense firewall management - 88 tools providing access to 2000+ methods through AI assistants
★ 36JavaScriptupdated 2025-07-06ai-assistantapiautomationclaudedevops
RhinoMCP connects Rhino 3D to AI Agent through the Model Context Protocol (MCP)
★ 365Pythonupdated 2026-03-16
MCP server for AutoCAD LT v3.1: freehand AutoLISP execution, 8 consolidated tools, File IPC + ezdxf backends, focus-free dispatch, undo/redo, P&ID symbols, and robust IPC with ESC prefix and UTF-8 fallback. Companion agent skill: puran-water/autocad-drafting
★ 216Pythonupdated 2026-02-20
AI-Powered Revit Modeling
★ 398TypeScriptupdated 2026-02-25mcprevit
MCP server that provides tools and resources for interacting with n8n API
★ 1,604TypeScriptupdated 2025-07-09
nocodb mcp server
★ 69JavaScriptupdated 2026-03-30mcpmcp-servernocodb
★ 14Pythonupdated 2025-04-14
Put an end to code hallucinations! GitMCP is a free, open-source, remote MCP server for any GitHub project
★ 7,981TypeScriptupdated 2026-03-13agentic-aiagentsaiclaudecopilot
A curated list of Model Context Protocol (MCP) servers
★ 4,005updated 2026-04-06
Monitor browser logs directly from Cursor and other MCP compatible IDEs.
★ 7,202JavaScriptupdated 2026-03-18aianthropiccursormcpmcp-server
Official Notion MCP Server
★ 4,263TypeScriptupdated 2026-03-18
Chrome MCP Server is a Chrome extension-based Model Context Protocol (MCP) server that exposes your Chrome browser functionality to AI assistants like Claude, enabling complex browser automation, content analysis, and semantic search.
★ 11,299TypeScriptupdated 2026-01-06
A MCP server implementation for hyperbrowser
★ 759TypeScriptupdated 2025-11-20
LangChain 🔌 MCP
★ 3,503Pythonupdated 2026-04-16langchainlanggraphmcppythontools
★ 20,624Pythonupdated 2026-01-23
MCP Toolbox for Databases is an open source MCP server for databases.
★ 14,815Goupdated 2026-04-20agentagentsaibigqueryclickhouse
Your API ⇒ Paid MCP. Instantly.
★ 18,130TypeScriptupdated 2026-02-11agentsaillmsopenai
Playwright MCP server
★ 31,413TypeScriptupdated 2026-04-19mcpplaywright
Official MCP Servers for AWS
★ 8,869Pythonupdated 2026-04-20awsmcpmcp-clientmcp-clientsmcp-host
★ 354JavaScriptupdated 2026-01-03
★ 3TypeScriptupdated 2025-03-21
🤗 AutoTrain Advanced
★ 4,571Pythonupdated 2026-04-17autotraindeep-learninghuggingfacemachine-learningnatural-language-processing
A PyTorch-based Speech Toolkit
★ 11,475Pythonupdated 2026-04-03asraudioaudio-processingdeep-learninghuggingface
The official Contentful command line interface. Use Contentful features straight from the command line!
★ 355JavaScriptupdated 2026-04-16apiclicontentfuljson
Model Context Protocol (MCP) server for the Webflow Data API.
★ 125TypeScriptupdated 2026-04-16built-with-fernbusiness-critical-yesgenerated-from-openapimcp-servermodel-context-protocol
Elegantly record your screen
★ 3,344Rustupdated 2026-04-20gnomegstreamergtk-rsgtk4gtk4-rs
Home Assistant MCP Server
★ 289Pythonupdated 2025-08-05home-assistanthome-automationmcpmcp-server
An mcp for nuclino
★ 1TypeScriptupdated 2025-11-25
MCP (Model Context Protocol) server for the Contentful Management API
★ 60TypeScriptupdated 2026-01-17
On-device wake word detection powered by deep learning
★ 4,798Pythonupdated 2026-04-17handsfreehotwordhotword-detectionhotword-detectorkeyword-spotter
Android app demonstrating on-device wake word voice recognition using the PocketSphinx engine
★ 29Kotlinupdated 2022-08-28
This repository offers a sample code illustrating the implementation of passkeys using the WebAuthn protocol
★ 93SCSSupdated 2024-06-30
An open-source audio wake word (or phrase) detection framework with a focus on performance and simplicity.
★ 2,146Jupyter Notebookupdated 2025-12-30
A MCP for Claude Desktop / Claude Code / Windsurf / Cursor to build n8n workflows for you
★ 18,722TypeScriptupdated 2026-04-20mcpmcp-servern8nworkflows
Reolink Camera API written in Python 3.6
★ 283Pythonupdated 2025-06-19reolinkreolink-apireolink-camerareolink-clientreolink-python-api
An RTSP bridge to Reolink IP cameras
★ 993Rustupdated 2024-05-01reolinkrtsprtsp-server
Home Assistant Reolink addon
★ 555Pythonupdated 2023-04-06
Reolink API official and unofficial documentations
★ 55updated 2024-04-26documentationreolinkreolink-api
🎧 Your Personal Streaming Service
★ 20,701Goupdated 2026-04-20airsonicmadsonicmedia-servermusicmusic-server
A curated collection of automation blueprints for Home Assistant.
★ 1,398MDXupdated 2026-02-03assistantautomationautomation-blueprintsautomation-hubblueprints
https://flowdown.ai/
★ 1,065Swiftupdated 2026-04-19
Model Context Protocol (MCP) Server for reading from Google Drive and editing Google Sheets
★ 273TypeScriptupdated 2025-05-07
A high-performance inference engine for AI models
★ 1,568Rustupdated 2026-04-20aihigh-performanceinferencellmmetal
This repository contains the specification files for PayPal REST APIs.
★ 392updated 2026-04-07openapiopenapi-specopenapi-specificationopenapi3paypal
Advanced Search for Twitter.
★ 1,565updated 2024-01-31advanced-searchosintsearchtweetdecktwitter
Shell script to automate downloading DaVinci Resolve and running Daniel Tufvesson's MakeResolveDeb to convert it into a .deb package, then installing it. For Debian/Ubuntu-based distros.
★ 23Shellupdated 2026-04-18davinci-resolvedavinci-resolve-studiodebiandebian-packageslinux
Web interface for Snapcast
★ 142TypeScriptupdated 2025-12-15snapcasttypescriptwebappwebclientwebinterface
A :baby: buddy to help caregivers track sleep, feedings, diaper changes, tummy time and more to learn about and predict baby's needs without (as much) guess work.
★ 2,745Pythonupdated 2026-04-19babydashboarddjangoparentingparents
Server for Squeezebox and compatible players. This server is also called Lyrion Music Server.
★ 1,688Perlupdated 2026-04-16logitech-media-serverlyrionlyrion-music-servermusicperl
Multiroom music for Home Assistant (via snapcast)
★ 28Shellupdated 2025-03-07
Mopidy is an extensible music server written in Python
★ 8,492Pythonupdated 2026-04-19mopidymusic-playerpython
Frame is an AI-powered, open-source vibe video editor, offering a Professional VIDEO cuting alternative for creators. With Cursor-like interaction, it automates editing, enhances videos, and delivers a seamless vibe video editing experience.
★ 213updated 2025-05-06ai-video-agentcursorvideo-cupvideo-editingvideo-editor
"VideoAgent: All-in-One Agentic Framework for Video Understanding, Editing, and Remaking"
★ 603Pythonupdated 2025-10-17agentsaudio-editingaudio-understandingllm-agentsnotebooklm
"ViMax: Agentic Video Generation (Director, Screenwriter, Producer, and Video Generator All-in-One)"
★ 2,711Pythonupdated 2026-03-29agentic-aigcvideo-generation
AI video agents framework for next-gen video interactions and workflows.
★ 1,367Pythonupdated 2026-01-23agentagent-frameworkai-agentsframeworkllm
Text-audio foundation model from Boson AI
★ 8,029Pythonupdated 2026-01-18
A repository to support the Leeds Data Science presentation
★ 1Pythonupdated 2023-07-03
Cross-platform GUI written in Rust using ADB to debloat non-rooted Android devices. Improve your privacy, the security and battery life of your device.
★ 6,463Rustupdated 2026-04-13adbandroidbloatware-listbloatware-removaldebloat
Cross-platform GUI written in Rust using ADB to debloat non-rooted android devices. Improve your privacy, the security and battery life of your device.
★ 19,228Rustupdated 2024-08-02adbandroiddebloatprivacy
Snapcast client for Android
★ 222Javaupdated 2025-09-23androidmultiroom-audiosnapcastsonos
Lightweight headless squeezebox player for Lyrion Media Server
★ 491Cupdated 2026-04-20
★ 7Dockerfileupdated 2022-08-19
Android Alarm Panel for Home Assistant and Home Automation Platforms (http://thanksmister.com/android-mqtt-alarm-panel/)
★ 193Kotlinupdated 2022-06-26alarm-panelandroidhome-assistanthome-automationmqtt
LCD touchscreen for Home Automation
★ 739C++updated 2022-01-09arduinoesp8266esp8266-arduinohomeassistanthomeautomation
★ 1,347updated 2026-04-02
🛏 An HTML to Markdown converter written in JavaScript
★ 11,108HTMLupdated 2026-04-03browsercommonmarkgfmhtmlhtml-to-markdown
Simple and powerful voice changer for Linux, written with Python & GTK
★ 1updated 2025-07-19
Audio Cleaner using DeepFilterNet, hosted through Streamlit
★ 27Pythonupdated 2025-05-04audio-processingnoise-reduction
Noise supression using deep filtering
★ 4,095Pythonupdated 2024-10-17audiodeep-learningnoise-suppressionpytorchrust
A comprehensive camera card for Home Assistant
★ 1,033TypeScriptupdated 2026-04-19cctvfrigatehome-assistantnvr
A modular framework built to simplify Computer Vision inference workloads.
★ 177Pythonupdated 2025-09-04computer-visiondeep-learningnodesobject-detectionobject-tracking
Moonfire NVR, a security camera network video recorder
★ 1,688Rustupdated 2026-04-07cameraip-camerajavascriptnvrrtsp
Show keyboard, gamepad and mouse input on stream
★ 3,957C++updated 2026-03-07inputkeyboardobsoverlayplugin
Move transition for OBS Studio
★ 859Cupdated 2026-04-11
SRS is a simple, high-efficiency, real-time media server supporting RTMP, WebRTC, HLS, HTTP-FLV, HTTP-TS, SRT, MPEG-DASH, and GB28181, with codec support for H.264, H.265, AV1, VP9, AAC, Opus, and G.711.
★ 28,769C++updated 2026-04-19audiocc-plus-plusdashhevc
NVR with realtime local object detection for IP cameras
★ 31,587TypeScriptupdated 2026-04-20aicameragoogle-coralhome-assistanthome-automation
NVR like user Interface for RTSP capable cameras
★ 1,033Vueupdated 2024-07-30awscameracamerauidetectiongui
★ 59Pythonupdated 2025-12-11
A web tool for converting BIP39 mnemonic codes
★ 4,153JavaScriptupdated 2024-04-28
Curated List of Biomarkers, Blood Tests, and Blood Tracking
★ 447updated 2021-09-15awesomeawesome-listbiomarker-discoverybiomarkersblood
CodeProject.AI Server is a self contained service that software developers can include in, and distribute with, their applications in order to augment their apps with the power of AI.
★ 957C#updated 2025-07-14artificial-intelligencegenerative-aimlopsobject-detectiononnx
The Restreamer is a complete streaming server solution for self-hosting. It has a visually appealing user interface and no ongoing license costs. Upload your live stream to YouTube, Twitch, Facebook, Vimeo, or other streaming solutions like Wowza. Receive video data from OBS and publish it with the RTMP and SRT server.
★ 4,995HTMLupdated 2025-12-29ffmpegffmpeg-apiffmpeg-serverh264hls
Ultimate camera streaming application
★ 12,882Goupdated 2026-03-23ffmpeggogolanghassiohls
Synchronous multiroom audio player
★ 7,595C++updated 2026-03-10audioaudio-playeraudio-streaminglmsmultiroom-audio
Kimi K2 is the large language model series developed by Moonshot AI team
★ 10,682updated 2026-01-21
Websites and tools for OSINT investigations pertaining to Israel
★ 79updated 2023-11-05
Browser extension (Firefox, Chrome, Opera, Edge) to redirect urls based on regex patterns, like a client side mod_rewrite.
★ 2,023JavaScriptupdated 2025-07-27
An open-source framework for making universal native apps with React. Expo runs on Android, iOS, and the web.
★ 49,023TypeScriptupdated 2026-04-20androidapp-frameworkexpoframeworkfrontend
AIMSICD • Fight IMSI-Catcher, StingRay and silent SMS!
★ 5,241Javaupdated 2026-02-27android
Alternative Twitter front-end
★ 12,835Nimupdated 2026-04-16nimprivacyself-hostedtwitterx
OSINT Tools for the Dark Web
★ 2,068updated 2025-05-22darkwebosint-toolsscraping-toolssearch-engines
Tookie is a advanced OSINT information gathering tool that finds social media accounts based on inputs.
★ 2,148Pythonupdated 2026-04-09cyber-securitycybersecurityhacking-toolhacking-toolsinformation-gathering
OSINT cheat sheet, list OSINT tools, wiki, dataset, article, book , red team OSINT for hackers and OSINT tips and OSINT branch. This repository will grow every time will research, there is a research, science and technology, tutorial. Please use it wisely.
★ 1,897HTMLupdated 2026-04-19cheatsheetcybersecuritydatasetseducationhacking
🕵️‍♂️ All-in-one OSINT tool for analysing any website
★ 32,905TypeScriptupdated 2026-04-08osintprivacysecuritysecurity-toolssysadmin
SpiderFoot automates OSINT for threat intelligence and mapping your attack surface.
★ 17,555Pythonupdated 2026-04-13attacksurfacecticybersecurityfootprintinghacking
📚 A Curated List of Awesome Telegram OSINT Tools, Sites & Resources
★ 2,665updated 2024-08-03awesomeawesome-listosintosint-resourcestelegram
An automated e-mail OSINT tool
★ 5,794Goupdated 2024-02-02automationdata-breachemailemail-checkergo
It's like v0 but in your Cursor/WindSurf/Cline. 21st dev Magic MCP server for working with your frontend like Magic
★ 4,791TypeScriptupdated 2026-02-17
🚀 Powerful Local AI Chat Application - Mcp, Secure, Efficient, Personalized 本地化部署的大模型客户端
★ 336JavaScriptupdated 2025-06-25deepseekmcpmcp-client
Open-source context retrieval layer for AI agents
★ 6,260Pythonupdated 2026-04-20agent-infrastructureaiai-agentsai-infrastructureapi
The first and largest GPTs database
★ 76updated 2023-11-15chatgptgpt-storegptsgptstore
TWRPBuilder Android app
★ 217Javaupdated 2018-09-25androidapptwrptwrp-buildertwrp-recovery
TWRP Device Tree for Samsung Galaxy A23 5G
★ 3updated 2024-03-16
Micro service receiving mails and posting them to web hooks.
★ 46Goupdated 2021-08-02
Telegram Desktop messaging app
★ 31,549C++updated 2026-04-20messengermulti-platformtelegramtelegram-desktoptelegram-solution
Get started with building Fullstack Agents using Gemini 2.5 and LangGraph
★ 18,121Jupyter Notebookupdated 2026-04-16geminigemini-api
A gallery that showcases on-device ML/GenAI use cases and allows people to try and use models locally.
★ 22,054Kotlinupdated 2026-04-17
Lightweight, simple embedded Open WebUI widget, allowing you to easily implement chatbot capabilities and RAG workflows into your existing tools, apps and webpages!
★ 114Svelteupdated 2025-09-03aiartifical-intelligencellmopen-webuiopenwebui
Lemonade helps users discover and run local AI apps by serving optimized LLMs right from their own GPUs and NPUs. Join our discord: https://discord.gg/5xXzkMu8Zk
★ 3,676C++updated 2026-04-19aiamdgenaigpullama
A Python package and CLI for parsing aggregate and forensic DMARC reports
★ 1,232Pythonupdated 2026-04-20
A Form and Data Management Platform for Progressive Web Applications.
★ 2,279HTMLupdated 2026-03-26angularangularjsformsnodejsreact
Open Source Qualtrics Alternative
★ 12,139TypeScriptupdated 2026-04-20experience-managementformformsnextjsopen-source
SeaweedFS is a distributed storage system for object storage (S3), file systems, and Iceberg tables, designed to handle billions of files with O(1) disk access and effortless horizontal scaling.
★ 31,739Goupdated 2026-04-20blob-storagecloud-drivedistributed-file-systemdistributed-storagedistributed-systems
Speech Synthesis Markup Language editor for Windows
★ 9C#updated 2026-04-16
Rich Voice Editor: Quill Rich Text Editor Enhancements to support SSML
★ 90JavaScriptupdated 2020-03-23
Real-time microphone noise suppression on Linux.
★ 10,228Goupdated 2025-01-13hacktoberfesthacktoberfest2023linuxnoise-reductionnoise-suppression
Private voice keyboard, AI chat, images, webcam, recordings, voice control with >= 4 GiB of VRAM.
★ 289Pythonupdated 2025-12-30aiassistant-chat-botsassistive-technologyclientclient-server
ScribeWizard: Generate organized notes from audio using Groq, Whisper, and Llama3
★ 504Pythonupdated 2025-08-12aigroqgroq-apillama3replit
Speech to Text but with all the bells and whistles and most importantly AI! AI will clean up your filler words, edit and will refine what you said!
★ 332Pythonupdated 2025-02-09
Fine-tune the Whisper speech recognition model to support training without timestamp data, training with timestamp data, and training without speech data. Accelerate inference and support Web deployment, Windows desktop deployment, and Android deployment
★ 1,211Cupdated 2025-12-17androidasrchinesectranslate2huggingface
WhisperPlus: Faster, Smarter, and More Capable 🚀
★ 1,947Pythonupdated 2026-03-02
Whisper.net. Speech to text made simple using Whisper Models
★ 906C#updated 2026-03-16cross-platformdotnetdotnetcorehacktoberfestspeech-recognition
Multilingual Automatic Speech Recognition with word-level timestamps and confidence
★ 2,803Pythonupdated 2025-09-09asrattention-is-all-you-needattention-mechanismattention-modelattention-network
Whisper realtime streaming for long speech-to-text transcription and translation
★ 3,603Pythonupdated 2025-11-12
High-performance GPGPU inference of OpenAI's Whisper automatic speech recognition (ASR) model
★ 10,356C++updated 2024-08-03
Port of OpenAI's Whisper model in C/C++
★ 49,040C++updated 2026-04-20inferenceopenaispeech-recognitionspeech-to-texttransformer
An Open Source text-to-speech system built by inverting Whisper.
★ 4,595Jupyter Notebookupdated 2025-12-14pytorchspeech-synthesistts
A voice transcription tool using faster-whisper that records audio and converts speech to text on Linux systems.
★ 7Pythonupdated 2025-02-20
One-key voice-to-transcription tool: record speech, transcribe locally with Whisper, then paste. Never lose your audio files anymore!
★ 8Pythonupdated 2026-03-23chatgptlinuxllmollamaopen-source
🤖 A JavaScript framework for building conversational UIs
★ 2,908TypeScriptupdated 2025-08-03botbotuichatconversational-uijavascript
🗃 Open source self-hosted web archiving. Takes URLs/browser history/bookmarks/Pocket/Pinboard/etc., saves HTML, JS, PDFs, media, and more...
★ 27,292Pythonupdated 2026-04-19archiveboxbackupsbookmark-archiverbrowser-bookmarkschromium
Small Gotify daemon to send messages as desktop notifications
★ 79Rustupdated 2026-03-04
Cross-platform desktop client for receiving messages from a Gotify server
★ 123Pythonupdated 2025-12-22clientcross-platformdesktopgotify
A simple server for sending and receiving messages in real-time per WebSocket. (Includes a sleek web-ui)
★ 14,898Goupdated 2026-04-20apicloudfree-softwaregolanggotify
Send push notifications to your phone or desktop using PUT/POST
★ 29,885Goupdated 2026-04-11curlnotificationsntfyntfyshpubsub
Mockoon is the easiest and quickest way to run mock APIs locally. No remote deployment, no account required, open source.
★ 8,226TypeScriptupdated 2026-04-20apiapplicationdesktopelectronmock
AI powered Kubernetes Assistant
★ 7,432Goupdated 2026-04-16aiassistantclikubernetes
WoeUSB-ng is a simple tool that enable you to create your own usb stick windows installer from an iso image or a real DVD. This is a rewrite of original WoeUSB.
★ 2,073Pythonupdated 2026-01-25bootable-drivesbootable-usbtoolwindowswindows-10
Android vendors, don't kill my app!
★ 1,613JavaScriptupdated 2026-02-10androiddontkillmyappvendors
Extracted system prompts from ChatGPT (GPT-5.4, GPT-5.3, Codex), Claude (Opus 4.6, Sonnet 4.6, Claude Code), Gemini (3.1 Pro, 3 Flash, CLI), Grok (4.2, 4), Perplexity, and more. Updated regularly.
★ 38,856updated 2026-04-18aiai-transparencyanthropicchatgptclaude
Qt Module to implement MQTT protocol version 3.1 and 3.1.1 http://mqtt.org/
★ 449C++updated 2026-04-17
🍯 T-Pot - The All In One Multi Honeypot Platform 🐝
★ 9,105Cupdated 2026-03-14deceptiondockerelkhoneypotnetwork-security
Advanced Honeypot framework.
★ 1,299Goupdated 2023-10-09frameworkhoneypotsecurity
an awesome list of honeypot resources
★ 10,246Pythonupdated 2025-04-01awesomeawesome-listhoneydhoneypotlist
A Home Assistant custom component to fetch pollen data from the Google Pollen API.
★ 56Pythonupdated 2025-03-23
HomeAssistant Custom Component for IEC
★ 175Pythonupdated 2026-04-19electrichacshome-assistantiec
HomeAssistant integration for getting the lastest hourly news of Galatz Radio station
★ 4Pythonupdated 2026-03-20hacs-integrationhome-assistantnews
Universal LLM Deployment Engine with ML Compilation
★ 22,526Pythonupdated 2026-04-20language-modelllmmachine-learning-compilationtvm
A powerful Whisper AI keyboard for reliable speech transcription
★ 199Javaupdated 2026-01-06aiandroidgptkeyboardopenai
An open-source long-horizon SuperAgent harness that researches, codes, and creates. With the help of sandboxes, memories, tools, skill, subagents and message gateway, it handles different levels of tasks that could take minutes to hours.
★ 63,806Pythonupdated 2026-04-20agentagenticagentic-frameworkagentic-workflowai
Israel Municipalities Polygons geojson
★ 2updated 2025-04-05
A GIS shapefile map of Israel.
★ 4updated 2017-05-11
Low-latency AI engine for mobile devices & wearables
★ 4,689Cupdated 2026-04-20aiandroidarmedgeedge-ai
The Cloud Native Webhooks Gateway
★ 2,793Goupdated 2026-04-17angularapi-gatewayautomationclicloud
This is the official repository for submitting MCP servers to be included in Cline's MCP Marketplace. If you’ve built an MCP server and want it to be discoverable and easily installable by millions of developers using Cline, submit your server here.
★ 766updated 2025-06-24
✂️ passwordless, anonymous SSH-powered pastebin with a human-friendly TUI and web UI
★ 1,270Goupdated 2026-04-01gopastebinsqlitesshtui
Prometheus ZFS exporter
★ 293Goupdated 2026-04-04golangprometheusprometheus-exporterzfs
📓 An MCP server for managing your personal knowledge, daily notes, and re-usable prompts via GitHub Gists
★ 189TypeScriptupdated 2026-01-16gistsmcpmcp-servernotetakingpkm
WallPanel is an Android application for Web Based Dashboards and Home Automation Platforms
★ 590Kotlinupdated 2025-05-05androidhome-assistantmqtt
Use your tablet as graphic tablet/touch screen on your computer.
★ 9,120Rustupdated 2026-04-14androidandroid-applicationappbrowserffmpeg
The leading open-source AI copilot for JetBrains. Connect to any model in any environment, and customize your coding experience in any way you like.
★ 1,888Kotlinupdated 2026-04-20codellamagpt-4intellijintellij-pluginjetbrains
★ 945Pythonupdated 2026-02-11
Export and Share your ChatGPT conversation history
★ 2,391TypeScriptupdated 2026-03-01aichatgptexportermarkdowntampermonkey
Tampermonkey is the most popular userscript manager, with over 10 million users. It's available for Chrome, Microsoft Edge, Safari, Opera Next, and Firefox.
★ 5,390JavaScriptupdated 2025-03-30
Violentmonkey provides userscripts support for browsers. It works on browsers with WebExtensions support.
★ 8,135JavaScriptupdated 2026-04-20userscripts-supportviolentmonkeywebextensions
Light-weight system monitor for X, Wayland, and other things, too
★ 8,305C++updated 2026-04-19c-plus-pluscairoconkyimlib2linux
Open-source customizable start page
★ 153TypeScriptupdated 2026-04-17productivitystartpagewidgets
A Model Context Protocol (MCP) server that provides authenticated access to Google Workspace APIs, offering integrated Authentication, Gmail, Calendar, and Drive functionality
★ 148TypeScriptupdated 2026-04-16aigoogle-workspacemcpmodel-context-protocol
★ 926Pythonupdated 2026-02-11
Fully customizable AI chatbot component for your website
★ 3,589TypeScriptupdated 2026-04-19aiai-chatbotchatchatbotchatgpt
Google Fonts CLI
★ 1JavaScriptupdated 2024-11-27
Network-wide ads & trackers blocking DNS server
★ 33,693Goupdated 2026-04-20adblockadguarddnsdns-over-httpsdns-over-quic
Limopola is an AI platform that allows you to communicate with a wide range of AI models. It features autonomous agents, model-agnostic reasoning, and more.
★ 111TypeScriptupdated 2025-12-13
Integrating AI into every workflow with our open-source, no-code platform, powered by the actor model for dynamic, graph-based solutions.
★ 313TypeScriptupdated 2025-02-27actor-frameworkagentagent-based-frameworkaichat
😎 Sagentic.ai Agent Framework - Sagentic.ai is a unified platform for building, running and scaling autonomous agents.
★ 76TypeScriptupdated 2026-03-10aiartificial-intelligenceautonomous-agentsgpt-4llm
A Multi-Agent framework that enables AI agents to collaborate effectively, helping you build powerful agent teams for solving complex tasks.
★ 266Pythonupdated 2026-04-01agentagent-collaborationagentmeshllmmulti-agent
Plura is a powerful tool for creating, managing, and deploying AI agents. Built with TypeScript, it helps you develop intelligent agents that integrate with mini services, interact across platforms, maintain consistent personalities and knowledge, and automate tasks seamlessly.
★ 48TypeScriptupdated 2026-02-19agentsaiai-agents
ACI.dev is the open source tool-calling platform that hooks up 600+ tools into any agentic IDE or custom AI agent through direct function calling or a unified MCP server. The birthplace of VibeOps.
★ 4,756Pythonupdated 2026-01-08agentsaiai-agentsapideveloper-tools
Tiledesk is the open source AI agent builder, written in Node.js and Angular. This repository is dedicated to the WebApp dashboard to manage Tiledesk: open-source alternative to Voiceflow, enabling easy creation of advanced LLM-powered Agents with seamless human-in-the-loop (HITL).
★ 314TypeScriptupdated 2026-04-20ai-agentsangualr5angularbotchat
Voice native AI agent for the builders of tomorrow
★ 191JavaScriptupdated 2025-01-01accessibilityassistive-technologycoding-assistantnatural-language-programmingspeech-to-code
Giselle: AI App Builder. Open Source.
★ 519TypeScriptupdated 2026-04-17agentagent-builderagentic-aiaiai-agent
Open-source AI coworker, with memory
★ 13,101TypeScriptupdated 2026-04-20agentsagents-sdkaiai-agentsai-agents-automation
List of email spy pixels blocked by Simplify Gmail
★ 36Rubyupdated 2022-02-11
Ultimate repo for embedded devices
★ 2,715Cupdated 2026-04-06buildrootentware
Open-source KVM software
★ 7,829C++updated 2025-12-01
Backup utility for Libvirt / qemu / kvm supporting incremental and differential backups + instant recovery (agentless).
★ 492Pythonupdated 2026-03-20backupbackup-imagebackup-managerbackup-scriptbackup-solution
The Autonomous Company Operating System
★ 19,655TypeScriptupdated 2026-04-20aiai-agentsllm
Software to automate the management and configuration of infrastructure and applications at scale.
★ 15,355Pythonupdated 2026-04-20cloudcloud-managementcloud-providerscloud-provisioningconfiguration-management
remote access and remote management
★ 19updated 2023-09-20
Do-It-All Mechanical Macropad
★ 1,316Cupdated 2026-03-15duckyscriptkeyboardmacropadmechanical-keyboardmechanical-switches
Speedtest Exporter made in python using the official speedtest bin
★ 236Pythonupdated 2026-04-09clidockerexportergrafana-dashboardmetrics
★ 25TypeScriptupdated 2025-04-08
export your mizrahi-tefahot.co.il credit card and checkin transactions into .qif ; ייבוא פעולות אשראי וחשבון מאתר בנק המזרחי לפורמט .qif
★ 4CoffeeScriptupdated 2015-10-19
★ 37updated 2026-04-20
Collection of publicly available IPTV channels from all over the world
★ 115,152TypeScriptupdated 2026-04-20iptvm3uplayliststreamstv
Run GGUF models easily with a KoboldAI UI. One File. Zero Install.
★ 10,309C++updated 2026-04-20gemmaggmlggufkoboldaikoboldcpp
Simple PHP Wrapper for the World Air Quality Index API
★ 24PHPupdated 2026-03-20air-qualityapiapi-wrappermonitoring-stationphp
ContextGem: Effortless LLM extraction from documents
★ 1,823Pythonupdated 2026-03-16aicontract-analysisdata-extractiondocument-intelligencedocx
A framework for creating e-books from Markdown using Ruby. Using the Prince PDF generator, you'll be able to get high quality PDFs. Also supports EPUB, Mobi, Text and HTML generation.
★ 687Rubyupdated 2025-12-12
📊 An infographics generator with 30+ plugins and 300+ options to display stats about your GitHub account and render them as SVG, Markdown, PDF or JSON!
★ 16,506JavaScriptupdated 2026-04-16automatedautomationgithubgithub-actiongithub-api
Markdown editor with pandoc integration and paginated preview.
★ 1,249TypeScriptupdated 2026-02-24editorelectronmarkdownmarkdown-convertermarkdown-editor
A VSCode extension that lets you find and install Agent Skills and MCP Apps to use with GitHub Copilot, Claude Code, and Codex CLI.
★ 487TypeScriptupdated 2026-03-12agent-skillsclaude-code-skillsclaude-skillscodex-skillscopilot
★ 1,950Pythonupdated 2026-04-13
Context7 Platform -- Up-to-date code documentation for LLMs and AI code editors
★ 53,733TypeScriptupdated 2026-04-18llmmcpmcp-servervibe-coding
CLI tool that uses Codex to turn natural language commands into their Bash/ZShell/PowerShell equivalents
★ 2,369Pythonupdated 2024-01-03
A simple CLI to run LLM prompt and implement MCP client.
★ 672Pythonupdated 2025-12-02langchainllmmcpmodel-context-protocol
Integrate AI Assistants with Django to build intelligent applications
★ 409Pythonupdated 2026-03-23aiai-agentai-assistantchatgptdjango
AI as Workspace - An elegant AI chat client. Full-featured, lightweight. Support multiple workspaces, plugin system, cross-platform, local first + real-time cloud sync, Artifacts, MCP | 更好的 AI 客户端
★ 1,801TypeScriptupdated 2026-04-15aichatgptclaudecross-platformdocker
🐚 OpenDevin: Code Less, Make More
★ 1,220updated 2024-04-18
The free and privacy-friendly screen recorder with no limits 🎥
★ 18,138JavaScriptupdated 2026-04-08annotationannotation-toolaudiocamerachrome-extension
Claude Desktop for Debian-based Linux distributions
★ 3,765Shellupdated 2026-04-20
Nix Flake for Claude Desktop on Linux
★ 347Nixupdated 2025-11-25
Generative UI SDK for React
★ 11,131TypeScriptupdated 2026-04-16agentagentsaiassistantassistant-chat-bots
AI Browser Automation
★ 1,294TypeScriptupdated 2026-02-14agentaiautomationchromellm
Setup script to install the prometheus stack on a synology NAS
★ 26Shellupdated 2020-02-28
Open source monitoring and visualization UI for the TICK stack
★ 1,567TypeScriptupdated 2026-04-15alertapmchronografdashboardgo
With Holoviews, your data visualizes itself.
★ 2,891Pythonupdated 2026-04-20holoviewsholovizplotting
pprof is a tool for visualization and analysis of profiling data
★ 9,151Goupdated 2026-04-02performanceperformance-analysispprofprofiler
The open and composable observability and data visualization platform. Visualize metrics, logs, and traces from multiple sources like Prometheus, Loki, Elasticsearch, InfluxDB, Postgres and many more.
★ 73,423TypeScriptupdated 2026-04-20alertinganalyticsbusiness-intelligencedashboarddata-visualization
Financial Markets Data Visualization using Matplotlib
★ 4,339Pythonupdated 2024-08-08candlestickcandlestick-chartcandlestickchartfinanceintraday-data
Device Metrics Exporter exports metrics from AMD devices (GPUs) to collectors like Prometheus.
★ 54Goupdated 2026-04-09
The AMD SMI Exporter exports AMD EPYC CPU & Datacenter GPU metrics to the Prometheus server.
★ 64Goupdated 2025-05-20
An MCP server to get Air Quality Data using AQICN.org
★ 1Pythonupdated 2025-02-04
[ICLR 2025] The First Multimodal Seach Engine Pipeline and Benchmark for LMMs
★ 494Pythonupdated 2026-04-05
Python tool for converting files and office documents to Markdown.
★ 117,108Pythonupdated 2026-04-15autogenautogen-extensionlangchainmarkdownmicrosoft-office
An open-source registry for VS Code extensions
★ 1,909Javaupdated 2026-04-20extensionmarketplaceregistrytheiavscode
High performance self-hosted photo and video management solution.
★ 98,632TypeScriptupdated 2026-04-20backup-toolfluttergoogle-photosgoogle-photos-alternativejavascript
Common Voice is part of Mozilla's initiative to help teach machines how real people speak.
★ 3,458TypeScriptupdated 2026-04-20crowdsourcinginternet-freedomopen-datavoice
FULL Augment Code, Claude Code, Cluely, CodeBuddy, Comet, Cursor, Devin AI, Junie, Kiro, Leap.new, Lovable, Manus, NotionAI, Orchids.app, Perplexity, Poke, Qoder, Replit, Same.dev, Trae, Traycer AI, VSCode Agent, Warp.dev, Windsurf, Xcode, Z.ai Code, Dia & v0. (And other Open Sourced) System Prompts, Internal Tools & AI Models
★ 136,104updated 2026-04-17aiboltcluelycopilotcursor
Just a Better Chatbot. Powered by Agent & MCP & Workflows.
★ 1,076TypeScriptupdated 2026-03-23agentaiai-chatbotautomationchatbot
Find rules and MCP servers
★ 3,925TypeScriptupdated 2026-04-17
n8n custom node for MCP
★ 3,007TypeScriptupdated 2026-01-02
Browser MCP is a Model Context Provider (MCP) server that allows AI applications to control your browser
★ 6,399TypeScriptupdated 2025-04-24browser-automationbrowser-extensionclaudecursormcp
OPNsense Exporter for Prometheus
★ 246Goupdated 2026-03-24grafanamonitoringopnsenseopnsense-firewallprometheus
★ 11updated 2024-11-14
SNMP Exporter for Prometheus
★ 2,103Goupdated 2026-04-14metricsmibmonitoringprometheusprometheus-exporter
Prometheus exporter for Hetzner Cloud
★ 41Goupdated 2026-04-20hcloudmetricsprometheusprometheus-exporter
Install, manage and develop MCP servers and skills for agents
★ 694TypeScriptupdated 2026-04-16
The AI Scientist: Towards Fully Automated Open-Ended Scientific Discovery 🧑‍🔬
★ 13,411Jupyter Notebookupdated 2025-12-19
Open and inexpensive DIY IP-KVM based on Raspberry Pi
★ 9,965updated 2026-04-06atxhardwarehdmiip-kvmipkvm
Memory engine and app that is extremely fast, scalable. The Memory API for the AI era.
★ 22,213TypeScriptupdated 2026-04-20agent-memoryai-memorycloudflare-kvcloudflare-pagescloudflare-workers
Build Hierarchical Autonomous Agents through Config. Collaborative Growth of Specialized Agents.
★ 326Pythonupdated 2023-11-27
OmniAI standardizes the APIs for multiple AI providers like OpenAI's Chat GPT, Mistral's LeChat, Claude's Anthropic, Google's Gemini and DeepSeek's Chat..
★ 251Rubyupdated 2026-04-17anthropicchatgptclaudedeepseekgemini
Dive endlessly deeper into a single concept using AI
★ 1Pythonupdated 2026-02-19calculusgeometrygeophysicshacktoberfesthacktoberfest2023
Prompt Super is a fully–featured template prompt that guides large‑language‑model assistants through every stage of academic writing: diagnosis, restructuring, editing, formatting, reproducibility and dissemination.
★ 1Pythonupdated 2025-04-18
A free and open-source tool designed to automate typing tasks, with built in AI for advanced users.
★ 1Pythonupdated 2025-04-19ollamapythontkinter-gui
A site dedicated to awesomely bad movies.
★ 2JavaScriptupdated 2010-09-08
About AI-Powered Medical Assistant 🏥🤖 The AI-Powered Medical Assistant is an intelligent healthcare platform that utilizes AI to assist users in symptom analysis, treatment recommendations, medical research, and patient management. By integrating advanced AI models and multiple innovative features, this project enhances healthcare accessibility,
★ 5HTMLupdated 2026-04-20bloggingdruidgraphhopehopenet
AI-powered interview assistant that conducts, evaluates, and scores candidates with real-time insights — helping you hire smarter and faster
★ 1TypeScriptupdated 2025-04-18
Med-Map is a web-based AI-powered application that helps users locate nearby pharmacies with specific medications in stock, while also providing smart health advice via an AI assistant. Designed with scalability in mind, it aims to bridge the gap between patients and accessible, reliable healthcare in Nigeria and beyond.
★ 1TypeScriptupdated 2025-06-02
🔥 MaxKB is an open-source platform for building enterprise-grade agents. 强大易用的开源企业级智能体平台。
★ 20,809Pythonupdated 2026-04-20agentagentic-aichatbotdeepseek-r1knowledgebase
OpenHealth, AI Health Assistant | Powered by Your Data
★ 3,869TypeScriptupdated 2026-01-06aihealthcare
This repository contains the source code for the paper First Order Motion Model for Image Animation
★ 15,008Jupyter Notebookupdated 2024-11-14deep-learninggenerative-modelimage-animationmotion-retargeting
Lightweight coding agent that runs in your terminal
★ 77,924Rustupdated 2026-04-20
Home Assistant Community Add-ons
★ 1,567Jinjaupdated 2026-04-18addonsaddons-repositoryhome-assistanthomeassistantrepository
Access large language models from the command-line
★ 11,713Pythonupdated 2026-04-15aillmsopenai
Goxel: Free and Open Source 3D Voxel Editor
★ 3,121C++updated 2026-01-20voxel-editorsvoxels
🌩 Google Font Downloader is a CLI tool which allows you to download the needed Google Fonts, by providing the Google APIs url.
★ 167JavaScriptupdated 2022-11-15hacktoberfest
WilmerAI is one of the oldest LLM semantic routers. It uses multi-layer prompt routing and complex workflows to allow you to not only create practical chatbots, but to extend any kind of application that connects to an LLM via REST API. Wilmer sits between your app and your many LLM APIs, so that you can manipulate prompts as needed.
★ 811Pythonupdated 2026-04-18aigenerative-aillms
Backstage is an open framework for building developer portals
★ 33,205TypeScriptupdated 2026-04-20backstagecncfdeveloper-experiencedeveloper-portaldx
AI-api text generation
★ 175Pythonupdated 2026-03-01
📘 Zigbee2mqtt documentation
★ 829TypeScriptupdated 2026-04-19hacktoberfest
Claude Code is an agentic coding tool that lives in your terminal, understands your codebase, and helps you code faster by executing routine tasks, explaining complex code, and handling git workflows - all through natural language commands.
★ 117,955Shellupdated 2026-04-18
A question answering dataset in Modern Hebrew, containing 30,147 questions.
★ 26Jupyter Notebookupdated 2024-12-05
All Cursor AI's official download links for both the latest and older versions, making it easy for you to update, downgrade, and choose any version. 🚀
★ 3,187TypeScriptupdated 2026-04-20curosrcursorcursor-aicursor-ai-editorcursor-ide
An AI prompt project that uses AI to extract wisdom from all sorts of text, from podcast transcripts, conversations, talks, lectures, papers, articles, blog posts, essays, presentations, or whatever you can get into text form.
★ 139updated 2023-10-26
My own Prompts for Custom instructions ChatGPT
★ 2,654updated 2026-03-14
★ 6Pythonupdated 2025-04-17
★ 2,288Pythonupdated 2024-08-30
Multi-Platform Package Manager for Stable Diffusion
★ 8,045C#updated 2026-04-19aiautomatic1111avaloniacomfyuidotnet
Open device management
★ 6,288Goupdated 2026-04-19binary-authorizationconfiguration-managementdevice-managementgitopsios
AI-Powered Photos App for the Decentralized Web 🌈💎✨
★ 39,573Goupdated 2026-04-20aigolanggoogle-photosmachine-learningphotography
A self-hosted open source photo management service.
★ 7,980Pythonupdated 2026-04-17djangoexifhacktoberfestmachine-learningphoto
✨ Innovative and open-source visualization application that transforms various data formats, such as JSON, YAML, XML and CSV into interactive graphs.
★ 43,910TypeScriptupdated 2026-04-19csvdiagramsgraphjsonnextjs
程序员在家做饭方法指南。Programmer's guide about how to cook at home (Simplified Chinese only).
★ 1updated 2025-04-16
CLIP (Contrastive Language-Image Pretraining), Predict the most relevant text snippet given an image
★ 33,327Jupyter Notebookupdated 2026-03-25deep-learningmachine-learning
A terminal utility for intelligent shell command generation
★ 333Pythonupdated 2026-03-08aibashdeveloper-toolsfishgemini
An Arduino-like programming API for the CH55X
★ 539Cupdated 2026-02-02
AI toolkit in a box for AMD GPU owners on Ubuntu
★ 4Pythonupdated 2024-01-17
AMD (Radeon GPU) ROCm based setup for popular AI tools on Ubuntu 26.04
★ 222updated 2026-04-17
Lightpanda: the headless browser designed for AI and automation
★ 29,371Zigupdated 2026-04-20browserbrowser-automationcdpheadlessplaywright
A chat-based discovery tool leveraging AI function calling to explore diverse content via search APIs. Supports Gemini AI & OpenAI models.
★ 5TypeScriptupdated 2025-02-24aiapibuildwithgeminifunction-callinggemini
Scripts to download and run the latest Linux build of Chromium. A substitute for Chrome Canary on Linux.
★ 815Shellupdated 2023-08-22
☯️ A curated list of distraction-free tools
★ 30updated 2020-11-16awesomeawesome-listdistraction-freedistractionless
Sonori is a fully local STT app for Linux (Wayland).
★ 18Rustupdated 2026-03-14asrautomatic-speech-recognitionctranslate2linuxonnxruntime
Easy to use local storage management for Linux.
★ 848Rustupdated 2026-04-16dbuslinuxruststoragestratis
CLI for the Stratis project
★ 110Pythonupdated 2026-04-16
Job search Agent (AI) searches and applies to jobs on your behalf, creating tailored applications for positions that match your skills, making your entire job search hassle-free.
★ 142Pythonupdated 2026-04-13agentaiai-agentsassistantautomation
The TeamAI application allows users to create a team of AI powered assistants with individual capabilities, personas. The AI assistants will solve the task requested by the user as a team effort, each bot contributing with its respective capabilities. Supported providers are Ollama and OpenAI.
★ 7JavaScriptupdated 2025-09-09chat-applicationchatgptdall-egptgpt-4
🎯 AI-powered voice assistant for TickTick, enabling natural language task management through speech. Built with OpenAI's speech recognition and TickTick's API integration, this assistant helps you manage your todos hands-free - create tasks, set reminders, and organize your schedule using just your voice.
★ 54Pythonupdated 2025-02-24
★ 205Jupyter Notebookupdated 2026-04-17
LlamaIndex is the leading framework for building LLM-powered agents over your data.
★ 4updated 2025-04-13
Data-Verse is an end-to-end AI data analysis agent that automates data ingestion, cleaning, pattern extraction, and predictive modeling, culminating in interactive visualizations—providing a comprehensive alternative to traditional data analysts.
★ 20TypeScriptupdated 2025-03-30agentaianalyticsdatadata-analysis
★ 365updated 2025-12-01
Our vision is to provide communication capabilities for intelligent agents, allowing them to connect with each other to form a collaborative network of intelligent agents.
★ 300Pythonupdated 2026-04-20agentaidid
AgentKit: Build multi-agent networks in TypeScript with deterministic routing and rich tooling via MCP.
★ 846TypeScriptupdated 2026-04-08agentaiai-agent-frameworkai-agentsllm
Home of the AI workforce - Multi-agent system, AI agents & tools
★ 279Pythonupdated 2026-01-15clusteringcomputer-visionembeddingsnatural-language-processingnlp
Extensible AGI Framework
★ 784Pythonupdated 2026-04-16agent-basedagiaiartificial-intelligencepython
LYRAI is a Model Context Protocol (MCP) operating system for multi-AI AGENTs designed to extend the functionality of AI applications by enabling them to interact with financial networks and blockchain public chains. The server offers a range of advanced AI assistants, including blockchain public chain operations (SOLANA,ETH,BSC,etc.)
★ 136Pythonupdated 2025-03-18
JobSync is a self-hosted, open-source job application tracker and AI-powered career assistant. Built with Next.js and Shadcn UI, it helps job seekers manage their search journey with AI resume review, job matching, task logging, and application analytics—all while keeping your data private.
★ 530TypeScriptupdated 2026-04-19aiai-job-matchai-resume-analyzerapplication-trackerapplication-tracking-system
A desktop client for working with GitHub Gists
★ 5Javaupdated 2025-08-03hacktoberfest
A collection of various GitHub gists for hackers, pentesters and security researchers
★ 964updated 2017-11-04infosecpayloadpentestpetyaprivacy
Agent2Agent (A2A) is an open protocol enabling communication and interoperability between opaque agentic applications.
★ 23,428Shellupdated 2026-04-19a2aa2a-mcpa2a-protocola2a-serveragents
Local semantic search. Stupidly simple.
★ 453Pythonupdated 2024-07-07
The AI assistant for computer control.
★ 337TypeScriptupdated 2024-09-23
The #1 open-source voice interface for desktop, mobile, and ESP32 chips.
★ 5,112Pythonupdated 2024-11-01
JavaScript library to convert Hebrew script to Paleo-Hebrew / Phoenician script.
★ 6TypeScriptupdated 2022-07-06alphabetfinikihebrewhistoryletters
various ElasticSearch analyzer plugins useful for analyzing ancient Hebrew
★ 10Javaupdated 2023-08-28
A cross-platform program that interacts with PN532, supports Windows, Linux, and macOS.
★ 152JavaScriptupdated 2025-10-21libnfcmifarenfcnfc-card-readernfc-crack
ACS ACR122U NFC Reader
★ 119Pythonupdated 2018-08-27
Share files across the LAN
★ 1,510Cupdated 2026-04-13
OSAI: Your AI-powered OS assistant. Rename files, manage environment variables, set reminders, and control your system through natural language commands for Windows Macos and Linux. Streamline your workflow with intelligent file organization and automated tasks
★ 95TypeScriptupdated 2024-08-16
Add AI capabilities to your file system using Ollama, Groq, OpenAi and other's api
★ 209TypeScriptupdated 2025-01-04angularfilesystemgpt-4gpt-4ogroq
text and image to video generation: CogVideoX (2024) and CogVideo (ICLR 2023)
★ 12,679Pythonupdated 2025-11-04cogvideoximage-to-videollmsoratext-to-video
The world's smartest system-wide grammar assistant; a better version of the Apple Intelligence Writing Tools. Works on Windows, Linux, & macOS, with the free Gemini API, local LLMs, & more.
★ 2,209Swiftupdated 2026-03-01aiartificial-intelligencegeminigrammar-checkerlargelanguagemodel
💬 Fast, cross-platform CLI and GUI for batch transcription, translation, speaker annotation and subtitle generation using OpenAI’s Whisper on CPU, Nvidia GPU and Apple MLX.
★ 121Pythonupdated 2026-04-06asrautomatic-speech-recognitionmlxmlx-audiospeech-recognition
Input text from speech in any Linux window, the lean, fast and accurate way, using whisper.cpp OFFLINE. Speak with local LLMs via llama.cpp.
★ 172Shellupdated 2025-07-25accessibilityaibloat-freechatbotcli
OpenAPI Generator allows generation of API client libraries (SDK generation), server stubs, documentation and configuration automatically given an OpenAPI Spec (v2, v3)
★ 26,167Javaupdated 2026-04-20apiapi-clientapi-servergeneratorhacktoberfest
:electron: Build cross-platform desktop apps with JavaScript, HTML, and CSS
★ 121,039C++updated 2026-04-20c-plus-pluschromecsselectronhtml
A Fundamental End-to-End Speech Recognition Toolkit and Open Source SOTA Pretrained Models, Supporting Speech Recognition, Voice Activity Detection, Text Post-processing etc.
★ 15,852Pythonupdated 2026-03-17audio-visual-speech-recognitionconformerdfsmnparaformerpretrained-model
Playwright is a framework for Web Testing and Automation. It allows testing Chromium, Firefox and WebKit with a single API.
★ 87,324TypeScriptupdated 2026-04-20automationchromechromiume2e-testingelectron
★ 15Pythonupdated 2026-02-23
TerminalGPT - Terminal-based ChatGPT personal assistant app. Provides optimized, tailored answers for your machine's terminal.
★ 267Pythonupdated 2025-09-09aiassistantchatgptgenerative-aigenerative-model
A set of bash scripts to convert audio files into M4B audiobooks with chapter markers, customizable bitrate, book metadata and embedded cover art.
★ 42Shellupdated 2026-04-03audiobookbashm4bm4b-bookm4b-tool
Convert any URL to an LLM-friendly input with a simple prefix https://r.jina.ai/
★ 10,671TypeScriptupdated 2026-04-16llmproxy
Facebook AI Research Sequence-to-Sequence Toolkit written in Python.
★ 32,207Pythonupdated 2025-09-30artificial-intelligencepythonpytorch
🤖 AI-powered code generation tool for scratch development of web applications with a team collaboration of autonomous AI agents.
★ 225Pythonupdated 2026-04-16aiautonomous-agentcodebase-generationcodegencoding-assistant
★ 1Pythonupdated 2026-02-19
Local voice recording for creating Piper datasets
★ 212JavaScriptupdated 2026-02-20
Open-source framework for conversational voice AI agents
★ 10,447Pythonupdated 2026-04-14aimulti-modalreal-timevideovoice
Open models for Coqui STT
★ 155updated 2023-05-09deep-learningmodelsspeech-to-text
🔊 Text-Prompted Generative Audio Model
★ 39,092Jupyter Notebookupdated 2024-08-19
A local implementation of the Kokoro Text-to-Speech model, featuring dynamic module loading, automatic dependency management, and a web interface.
★ 293Pythonupdated 2026-03-07
RAG on Paul Graham's essays.
★ 2,670TypeScriptupdated 2023-07-28
The easiest way to use Agentic RAG in any enterprise
★ 4,431TypeScriptupdated 2025-01-22agenticagentsaidockerllamaindex
SuperEasy 100% Local RAG with Ollama + Email RAG
★ 1,223Pythonupdated 2024-06-04
Retrieval Augmented Generation (RAG) framework and context engine powered by Pinecone
★ 1,032Pythonupdated 2024-11-13generative-aillmragvector-database
A community-driven collection of RAG (Retrieval-Augmented Generation) frameworks, projects, and resources. Contribute and explore the evolving RAG ecosystem.
★ 1,715updated 2026-04-17aiartificial-intelligencelarge-language-modelsllmmachine-learning
★ 1,642TypeScriptupdated 2025-04-22
MCP server that interacts with TickTick (Dida 365) via the TickTick Open API
★ 283Pythonupdated 2025-07-30
🐸💬 - a deep learning toolkit for Text-to-Speech, battle-tested in research and production
★ 45,178Pythonupdated 2024-08-16deep-learningglow-ttshifiganmelganmulti-speaker-tts
🤖 Autonomous agent framework for Elixir. Built for distributed, autonomous behavior and dynamic workflows.
★ 1,665Elixirupdated 2026-04-14agentaiartificial-intelligenceelixirevent-driven-architecture
A fast, local neural text to speech system
★ 10,858C++updated 2025-08-26speech-synthesistext-to-speechtts
★ 34Jupyter Notebookupdated 2025-10-04
Build, deploy, and orchestrate AI agents. Sim is the central intelligence layer for your AI workforce.
★ 27,875TypeScriptupdated 2026-04-20agent-workflowagentic-workflowagentsaiaiagents
🥥 Coco AI App - Search, Connect, Collaborate, Personal AI Search and Assistant, all in one space.
★ 690TypeScriptupdated 2026-04-17ai-searchai-search-engineassistantcmd-kdeepseek
AI conversations that actually remember. Never re-explain your project to your AI again. Join our Discord: https://discord.gg/tyvKNccgqN
★ 2,925Pythonupdated 2026-04-20aiclaudeknowledge-managementknowlege-graphllm
AI-powered assistant to help you with your daily tasks, powered by Llama 3, DeepSeek R1, and many more models on HuggingFace.
★ 531Pythonupdated 2025-12-06deepseek-r1llamallama-3-2llama3llava
A pattern for an always on AI Assistant powered by Deepseek-V3, RealtimeSTT, and Typer for engineering
★ 989Pythonupdated 2025-01-12
Private AI platform for agents, assistants and enterprise search. Built-in Agent Builder, Deep research, Document analysis, Multi-model support, and API connectivity for agents.
★ 17,849Pythonupdated 2026-04-20agent-builderagentsaichatgptdocsgpt
Windsurf installer
★ 21Shellupdated 2025-02-24aiai-editorcodeiumwindsurf
A Python-based AI agentic assistant that uses Google's Gemini AI to provide natural language computer control through voice commands.
★ 10Pythonupdated 2025-03-27
Spongecake is the easiest way to launch computer use agents.
★ 179JavaScriptupdated 2025-04-25ai-agentsai-agents-frameworkautomationcomputer-usedocker
AI agents platform that gives you a workspace with an integrated team of personal assistants that can work behind the scenes to handle daily monotonous tasks.
★ 201Pythonupdated 2026-02-11agent-to-agentagentic-aiagentsaicli
fabric is an open-source framework for augmenting humans using AI.
★ 9Goupdated 2025-04-07
Fabric is an open-source framework for augmenting humans using AI. It provides a modular system for solving specific problems using a crowdsourced set of AI prompts that can be used anywhere.
★ 41,062Goupdated 2026-04-17aiaugmentationflourishinglifework
A library of shared system prompts for creating customized educational GPT agents.
★ 247updated 2024-12-18
Collection of leaked system prompts
★ 14,512updated 2026-03-30aidocumentllmprompt
A collection of GPT system prompts and various prompt injection/leaking knowledge.
★ 10,537HTMLupdated 2026-04-19gptpromptprompt-engineering
Prompt Management System for Interaction with the ChatGPT API
★ 23JavaScriptupdated 2026-04-07aiaudio-transcribingimage-generationprompt-databaseprompts
From bare metal PC to AI workloads in minutes.
★ 345Pythonupdated 2026-04-18
Neo AI integrates into the Linux terminal, capable of executing system commands and providing helpful information.
★ 134Pythonupdated 2026-03-09aigptiakali-linuxlinux
A sophisticated AI assistant system that processes natural language commands for email, calendar, and file management tasks. Built with modern web technologies and a beautiful, production-ready UI.
★ 4TypeScriptupdated 2025-02-05reacthooksreactjstailwindcssvite
A modern web application featuring an AI assistant named "Friday" with a futuristic UI and voice capabilities.
★ 1CSSupdated 2025-10-20
Open Source Web UI for AI/Assistants
★ 19TypeScriptupdated 2025-01-19artificial-intelligenceassistantopensourcereactreact-app
The original local LLM interface. Text, vision, tool-calling, training. UI + API, 100% offline and private.
★ 46,861Pythonupdated 2026-04-20
An MCP server that provides control over Android devices via adb
★ 735Pythonupdated 2025-05-28
The Official Model Context Protocol (MCP) server for Kagi search & other tools.
★ 370Pythonupdated 2026-04-08
Model Context Protocol server for Flight Tracking
★ 46JavaScriptupdated 2025-01-29
🔥 Official Firecrawl MCP Server - Adds powerful web scraping and search to Cursor, Claude and any other LLM clients.
★ 6,140JavaScriptupdated 2026-04-15batch-processingclaudecontent-extractiondata-collectionfirecrawl
Neo4j Labs Model Context Protocol servers
★ 940Pythonupdated 2026-04-10databasemcpmcp-serverneo4jstdio
Exa MCP for web search and web crawling!
★ 4,326TypeScriptupdated 2026-04-19code-searchcodesearchcrawlingmcpmcp-server
Search, create and update Airtable bases, tables, fields, and records using Claude Desktop and MCP (Model Context Protocol) clients
★ 73JavaScriptupdated 2025-01-27
:cloud: :rocket: :bar_chart: :chart_with_upwards_trend: Evaluating state of the art in AI
★ 2,016Pythonupdated 2026-04-20aiai-challengesangularjsartificial-intelligencechallenge
The Context Platform for your Data and AI Stack
★ 11,844Javaupdated 2026-04-20agent-platformcontext-managementdata-catalogdata-discoverydata-governance
A collection of examples that show how to use CrewAI framework to automate workflows.
★ 5,904Jupyter Notebookupdated 2026-04-14crewaiexamples
★ 1,020TypeScriptupdated 2026-04-16
Open-source text-to-SQL and text-to-chart GenBI agent with a semantic layer. Ask your database questions in natural language — get accurate SQL, charts, and BI insights. Supports 12+ data sources (PostgreSQL, BigQuery, Snowflake, etc.) and any LLM (OpenAI, Claude, Gemini, Ollama).
★ 15,013TypeScriptupdated 2026-04-16agentanthropicbedrockbigquerybusiness-intelligence
🧙 Build, run, and manage data pipelines for integrating and transforming data.
★ 8,710Pythonupdated 2026-04-02artificial-intelligencedatadata-engineeringdata-integrationdata-pipelines
The Generative AI Landscape - A Collection of Awesome Generative AI Applications
★ 8,904updated 2026-04-19aiartificial-intelligenceassistant-chat-botsassistive-technologyawesome
Chat with your database or your datalake (SQL, CSV, parquet). PandasAI makes data analysis conversational using LLMs and RAG.
★ 23,485Pythonupdated 2025-10-28aicsvdatadata-analysisdata-science
Sample code and notebooks for Generative AI on Google Cloud, with Gemini Enterprise Agent Platform
★ 16,723Jupyter Notebookupdated 2026-04-17agentsgcpgeminigemini-apigen-ai
Generative Models by Stability AI
★ 27,118Pythonupdated 2025-12-16
An AI Hedge Fund Team
★ 57,346Pythonupdated 2026-04-17
Crawl a site to generate knowledge files to create your own custom GPT from a URL
★ 22,241TypeScriptupdated 2025-07-07ai
Microsoft AI
★ 2,511Pythonupdated 2025-05-10
MCP Server to Use HuggingFace spaces, easy configuration and Claude Desktop mode.
★ 386TypeScriptupdated 2025-06-13
A Model Context Protocol (MCP) server for Gmail integration in Claude Desktop with auto authentication support. This server enables AI assistants to manage Gmail through natural language interactions.
★ 1,097JavaScriptupdated 2025-08-06
AI Chatbots in terminal for free
★ 3,143Goupdated 2026-03-14aichatbotchatgptcligo
Control your computer with a voice interface
★ 33Pythonupdated 2026-03-29
AI powered Linux
★ 50Pythonupdated 2025-02-21
Sell stuff and see what sticks
★ 8,960Rubyupdated 2026-04-20
GitHub's official MCP Server
★ 29,254Goupdated 2026-04-16githubmcpmcp-server
Generate videos from text using various Stable Diffusion Models via Text2Video-Zero.
★ 23Pascalupdated 2023-05-16aidelphilinuxmacosobject-pascal
Stable Diffusion Desktop client for Windows, macOS, and Linux built in Embarcadero Delphi.
★ 71Pascalupdated 2023-08-15aiartificial-intelligencecodeformerdeepfloyddelphi
Source for remoteintech.company — a community-maintained directory of remote-friendly tech companies
★ 40,267Nunjucksupdated 2026-04-08distributed-companieshacktoberfestjobs-searchjobsearchjobseeker
File Manager with AI Agent: A Python-based file management system with an AI agent that automatically organizes and compresses files based on their types.
★ 8Pythonupdated 2025-02-16
AI That Does File Shit For You!
★ 13Pythonupdated 2026-01-21aifile-organizationfile-summary
A CLI that organize and manage your files using AI
★ 204TypeScriptupdated 2025-11-18
Cross-platform desktop application for content-aware file organization and renaming. Supports local and remote LLMs, preview-based workflows, and fully user-controlled changes.
★ 688C++updated 2026-04-19aifile-managementfile-managerllmorganizer
★ 87Pythonupdated 2024-06-09
demo app: how to use LLM as a general purpose classifier
★ 108TypeScriptupdated 2023-06-04
Run frontier LLMs and VLMs with day-0 model support across GPU, NPU, and CPU, with comprehensive runtime coverage for PC (Python/C++), mobile (Android & iOS), and Linux/IoT (Arm64 & x86 Docker). Supporting OpenAI GPT-OSS, IBM Granite-4, Qwen-3-VL, Gemma-3n, Ministral-3, and more.
★ 7,973Kotlinupdated 2026-04-14gemma3gogpt-ossgranite4llama
A self-organizing file system with llama 3
★ 5,723TypeScriptupdated 2025-08-08
An AI-powered file management tool that ensures privacy by organizing local texts, images. Using Llama3.2 3B and Llava v1.6 models with the Nexa SDK, it intuitively scans, restructures, and organizes files for quick, seamless access and easy retrieval.
★ 3,186Pythonupdated 2024-10-21file-organizerllama3llmon-device-aivlm
★ 19updated 2025-02-13
AI-powered file launcher and semantic search assistant. Like Spotlight/Alfred but with advanced AI capabilities for understanding context and meaning. Features local processing, privacy-first design, and seamless integration with your workflow.
★ 15TypeScriptupdated 2025-09-25aialfreddesktopdocument-searchelectron
The semantic desktop search engine
★ 30Goupdated 2021-08-13desktop-searchknowledge-graphrdfsemantic-websparql
Neon Core extends Mycroft core with more modular code, extended multi-user support, and more.
★ 195Pythonupdated 2026-04-17
🎙️ Speak with AI - Run locally using Ollama, OpenAI, Anthropic or xAI - Speech uses SparkTTS, OpenAI, ElevenLabs, Kokoro, Typecast or xAI
★ 427Pythonupdated 2026-04-14ai-speechai-voiceai-voice-agentanthropic-claudeconversational-ai
Open AI Chat Bot in the Menu Bar: ChatGPT desktop app for Windows, Mac, and Linux
★ 60TypeScriptupdated 2026-01-08aiai-chatai-chatbotchatchatbot
Desktop AI assistant for Windows, Mac and Linux
★ 140JavaScriptupdated 2025-02-02appchatgptchatgpt-appcopilotcopilot-chat
Backend.AI Web UI for web / desktop app (Windows/Linux/macOS). Backend.AI Web UI provides a convenient environment for users, while allowing various commands to be executed without CLI. It also provides some visual features that are not provided by the CLI, such as dashboards and statistics.
★ 129TypeScriptupdated 2026-04-18backendbackendaidesktopelectronlit-element
Talk to your documents with Ollama and Langchain - supports CSV, PDF, DOCX, PPTX, TXT, XLSX.
★ 1Pythonupdated 2025-02-18
A Web application that lets you ask questions to your PDFs and CSV files. It also helps you create a fast Exploratory Data Analysis on your CSV file
★ 1Pythonupdated 2024-02-15
An LLM agent, to talk to your csvs.
★ 2Pythonupdated 2024-04-26
Talk to your CSV: how to Visualize Your Data with Langchain and Streamlit
★ 29Pythonupdated 2023-08-26
An application that enable the users to upload PDF files and ask questions regarding their content using Retrieval Augmented Generation (RAG)
★ 23Pythonupdated 2024-10-18aicosine-similarityembeddingsgoogle-drive-apigpt-4
An LLM GUI application; enables you to interact with your files, offering dynamic parameters that can modify response behavior during runtime.
★ 95Pythonupdated 2026-04-08chunkingdependency-inversion-principledockerembeddingsfactory-pattern
The Naomi Project is an open source, technology agnostic platform for developing always-on, voice-controlled applications!
★ 295Pythonupdated 2025-07-09assistanthacktoberfesthome-automationiotjarvis
Voice biometric authentication PAM module for Linux
★ 49Pythonupdated 2022-09-18biometricbiometric-authenticationbiometric-identificationbiometricsgmm
Transcribe on your own!
★ 5,849TypeScriptupdated 2026-04-19aicross-platformdesktopopenairust
Buzz transcribes and translates audio offline on your personal computer. Powered by OpenAI's Whisper.
★ 18,900Pythonupdated 2026-04-19whisper
WhisperX: Automatic Speech Recognition with Word-level Timestamps (& Diarization)
★ 21,502Pythonupdated 2026-04-04asrspeechspeech-recognitionspeech-to-textwhisper
An editing tool that uses AI to transcribe, understand content and search for anything in your footage, integrated with ChatGPT and other AI models
★ 936Pythonupdated 2025-02-26aichatgptdavinci-resolveeditingfilm-editing
Minimalist web-searching platform with an AI assistant that runs directly from your browser. Uses WebLLM, Wllama and SearXNG. Demo: https://felladrin-minisearch.hf.space
★ 559TypeScriptupdated 2026-04-20aiai-search-engineartificial-intelligencegenerative-aigpu-accelerated
Local-GenAI-Search is a generative search engine based on Llama 3, langchain and qdrant that answers questions based on your local files
★ 96Pythonupdated 2024-08-19generative-ailangchainlarge-language-modelsllama3local
🔍 DiscovAI-Search: An AI-powered search engine for AI tools and custom data. Built with Next.js, OpenAI, Supabase, and more. Features vector-based search, Redis caching, and LLM-powered responses.
★ 286TypeScriptupdated 2024-08-08ai-search-engineai-toolsai-tools-directorychatbotjina
Perplexity Inspired Answer Engine
★ 5,021TypeScriptupdated 2025-06-27
List of software that allows searching the web with the assistance of AI: https://hf.co/spaces/felladrin/awesome-ai-web-search
★ 1,286HTMLupdated 2026-03-04aiai-search-engineartificial-intelligenceartificial-intelligence-projectsawesome
🔍 AI search engine - self-host with local or cloud LLMs
★ 3,530TypeScriptupdated 2024-09-27fastapigenerative-uigpt-4ogroqllm
A metasearch library that aggregates results from diverse web search services
★ 2,557Pythonupdated 2026-04-20apiddgsdhtmcpmcp-server
Scira (Formerly MiniPerplx) is a minimalistic AI-powered search engine that helps you find information on the internet and cites it too. Powered by Vercel AI SDK!
★ 11,619TypeScriptupdated 2026-03-20ai-search-engineminimalistic-ai-search-engineopen-source-perplexity-aiperplexity-aiperplexity-alternative
An AI search engine inspired by Perplexity
★ 1,625TypeScriptupdated 2025-12-12
Search + Chat = SearChat(AI Chat with Search), Support OpenAI/Anthropic/VertexAI/Gemini, DeepResearch, SearXNG, Docker. AI对话式搜索引擎,支持DeepResearch, 支持OpenAI/Anthropic/VertexAI/Gemini接口、聚合搜索引擎SearXNG,支持Docker一键部署。
★ 1,043TypeScriptupdated 2026-04-16aianthropicdeepresearchgeminillm
Perplexity style AI Search engine clone built with Gemini 2.0 Flash and Grounding
★ 2,065TypeScriptupdated 2025-01-04
MemFree - Hybrid AI Search Engine & AI Page Generator
★ 1,495TypeScriptupdated 2025-08-08aiai-searchai-search-enginedevfastgenerate-ui
An AI-powered search engine with a generative UI
★ 8,790TypeScriptupdated 2026-04-15deepseek-r1generative-aigenerative-uinextjsollama
An implementation of iterative deep research using the OpenAI Agents SDK
★ 756Pythonupdated 2025-12-27agentic-aiagentsdeep-researchdeepresearchllms
"AutoAgent: Fully-Automated and Zero-Code LLM Agent Framework"
★ 9,221Pythonupdated 2025-10-16agentllms
Modular Python framework for AI agents and workflows with chain-of-thought reasoning, tools, and memory.
★ 2,523Pythonupdated 2026-04-17aianthropicclaudegpthuggingface
End-to-end platform for building voice first multimodal agents
★ 431Pythonupdated 2024-10-28anyscalechatgpt-apiclaude-3-sonnetdeepgramelevenlabs
Fine-tune LLM agents with online reinforcement learning
★ 1,251Pythonupdated 2024-03-19
In this repository I will showcase my cool multi agent system projects with Crew AI, and will reference other cool projects on the subject : )
★ 90Pythonupdated 2025-04-07crewaimultiagent-systemsprojectsprojects-done
🤖 Awesome list of AGI Agents. Agents 精选资源合集.
★ 524updated 2023-10-31agentsagents-artagiagi-agentsai
TapeAgents is a framework that facilitates all stages of the LLM Agent development lifecycle
★ 312Pythonupdated 2025-12-16agenticagentsai-agentsfinetuningllm-agent
Multi Agentic Architectures for complex problem-solving.
★ 27Jupyter Notebookupdated 2025-03-19
No code AI agents
★ 448C++updated 2025-01-16aiai-agentsartificial-intelligencecligpt
MAD: The first work to explore Multi-Agent Debate with Large Language Models :D
★ 556Pythonupdated 2025-12-16chatgptgpt-4large-language-modelsllmsnlp
Large Language Model based Multi-Agents: A Survey of Progress and Challenges (In IJCAI 2024)
★ 1,238updated 2026-04-19agentlarge-language-modelsllmllmsllms-reasoning
A generalized information-seeking agent system with Large Language Models (LLMs).
★ 1,197Pythonupdated 2024-06-19agiautogptautonomous-agentschatgptgpt
The Multi-Agent Reasoning framework creates an interactive chatbot where AI agents collaborate via structured reasoning and Swarm Integration for optimal answers. Simulating a team that discusses, debates, and refines responses, it enables complex problem-solving and precise results. Now with Prompt Caching to reduce latency and costs.
★ 181Pythonupdated 2025-01-23agent-based-modelingchatbotmulti-agento1openai
browser controlling AI agent that applies to relavant jobs on internet autonomously. join chat @ https://discord.gg/umgnyQU2K8
★ 683Pythonupdated 2024-09-09
🤖 Headless IDE for AI agents
★ 204Goupdated 2025-10-09
🤖🔎 STREAM: Search with Top Result Extraction & Answer Model 🔤📊 SEEKTOPIC 🚜📜 Tractor the Text Extractor 📈📝 REASON Docs Writing Agent
★ 72HTMLupdated 2025-12-29ai-searchautocompletehacktoberfestkeywordsknowledge-graph
A toolkit for building computer use AI agents
★ 194Pythonupdated 2025-06-26agentsllmmachine-learningmultimodal
See how to augment LLMs with real-time data for dynamic, context-aware apps - Rag + Agents + GraphRAG.
★ 165Jupyter Notebookupdated 2026-02-17agentsgenerative-aigraphraglanggraphllms
Devika is the first open-source implementation of an Agentic Software Engineer. Initially started as an open-source alternative to Devin.
★ 19,500Pythonupdated 2025-09-25
Problem solving by engaging multiple AI agents in conversation with each other and the user.
★ 247Pythonupdated 2023-12-27
This is MCP server for Claude that gives it terminal control, file system search and diff file editing capabilities
★ 5,953TypeScriptupdated 2026-04-20agentaicode-analysiscode-generationgemini-cli-extension
Open-Source Chrome extension for AI-powered web automation. Run multi-agent workflows using your own LLM API key. Alternative to OpenAI Operator.
★ 12,774TypeScriptupdated 2025-11-24agentaiai-agentsai-toolsautomation
🤖 A comprehensive list of 1,500+ resources and tools related to AI agents.
★ 1,596updated 2026-03-28agent-based-modelingagenticagentic-aiagentic-workflowagents
🤖 Assemble, configure, and deploy autonomous AI Agents in your browser.一键免费部署你的私人AutoGPT 网页应用
★ 3,006TypeScriptupdated 2025-02-10auto-gptconnect-aidockerdocker-composelangchangjs
Deploy, and share agents with open infrastructure, free from vendor lock-in.
★ 1,081Pythonupdated 2026-04-18
Hexabot is an open-source AI chatbot / agent builder. It allows you to create and manage multi-channel and multilingual chatbots / agents with ease.
★ 942TypeScriptupdated 2026-04-20agentagenticagentsaiartificial-intelligence
Autonomous Agents (LLMs) research papers. Updated Daily.
★ 1,241updated 2026-04-16agentagenticagentic-aiagentsai
Your toolkit for autonomous, evolving agent ecosystems. Create, execute, govern, and evolve agents that learn from experience, collaborate, build new capabilities, and operate safely within defined guardrails.
★ 450Pythonupdated 2025-11-24agentsaiaiagentsevolutionevolutionary-algorithm
🔥 A list of tools, frameworks, and resources for building AI web agents
★ 1,408Pythonupdated 2026-04-16aiai-agentsawesomeawesome-listbrowser-automation
Autopilot and the agent network
★ 404Rustupdated 2026-04-20
Build autonomous AI agents! 🌞
★ 186Rustupdated 2026-04-19
✨ Fully autonomous AI Agent that can perform complicated tasks and projects using terminal, browser, and editor.
★ 2,445TypeScriptupdated 2024-04-29agentaiautonomous-agentsbotdevin
Web UI for AutoGen (A Framework Multi-Agent LLM Applications)
★ 997TypeScriptupdated 2024-11-14agent-based-frameworkaiai-agentsautogenautogen-sample
TypeScript AI AI Function Calling Framework enhanced by compiler skills.
★ 1,021TypeScriptupdated 2026-04-14agentagenticagentic-aiagentic-frameworkai
An agent benchmark with tasks in a simulated software company.
★ 690Pythonupdated 2025-11-17agentaiai-benchmarkai-researchbenchmark
Master the art of designing and organizing AI agents. Learn to automate complex, multi-step business processes by creating specialized AI agent teams using the open-source library crewAI.
★ 153Jupyter Notebookupdated 2024-06-11agent-cooperationai-agentsai-memoryai-workflow-optimizationbusiness-process-automation
AI-agents that automatically generate and use Langchain Tools and ChatGPT plugins
★ 533TypeScriptupdated 2023-04-19
This program uses CrewAI to build a web-app using three agents doing some research stuff in the internet.
★ 74Pythonupdated 2024-03-31
A database of SDKs, frameworks, libraries, and tools for creating, monitoring, debugging and deploying autonomous AI agents
★ 1,167updated 2025-02-26agentagentopsagentsaiai-agents
🧠 Second Brain AI agent
★ 289Pythonupdated 2026-04-05artificial-intelligencechatgptchatgpt-apichatgpt-botlangchain
An open-source framework for collaborative AI agents, enabling diverse, distributed agents to team up and tackle complex tasks through internet-like connectivity.
★ 820Pythonupdated 2025-10-04agentaigenaiioallm
Welcome to AgentGenesis, your source for customizable Gen AI code snippets that you can easily copy and paste into your applications.
★ 118TypeScriptupdated 2026-03-31aicontentlayergenerative-aihacktoberfesthacktoberfest-accepted
Dynamiq is an orchestration framework for agentic AI and LLM applications
★ 1,039Pythonupdated 2026-04-20agentsaigenerative-aigptllm
A user-friendly, multi-platform GUI for managing and running CrewAI agents and tasks. Supports Conda and virtual environments, no coding needed.
★ 1,243Pythonupdated 2026-03-27agentsaicrewaicrewaiguicrewaiui
Complete MCP Platform -- Hosting, Registry, Gateway, and Chat Client
★ 726Goupdated 2026-04-17aichatmcpmodelcontextprotocol
A modular high-level library to train embodied AI agents across a variety of tasks and environments.
★ 2,957Pythonupdated 2026-02-21aicomputer-visiondeep-learningdeep-reinforcement-learningpython
An introduction to the world of AI Agents
★ 268Jupyter Notebookupdated 2026-03-06agentagentic-aiagentsaiautogen
an open source, extensible AI agent that goes beyond code suggestions - install, execute, edit, and test with any LLM
★ 43,281Rustupdated 2026-04-20acpaiai-agentsmcp
BaseAI — The Web AI Framework. The easiest way to build serverless autonomous AI agents with memory. Start building local-first, agentic pipes, tools, and memory. Deploy serverless with one command.
★ 1,228TypeScriptupdated 2026-04-09aianthropicartificial-intelligencebaseaicohere
ZerePy an open-source framework for AI agents written in Python
★ 579Pythonupdated 2025-03-10
🔍 An LLM-based Multi-agent Framework of Web Search Engine (like Perplexity.ai Pro and SearchGPT)
★ 6,851JavaScriptupdated 2025-07-04ai-search-enginegptllmllmsmulti-agent-systems
An AutoGPT agent that controls Chrome on your desktop
★ 1,742Pythonupdated 2023-10-25aiautogptchatgptgpt-3-5-turbogpt-4
Ship AI Agents to Google Cloud in minutes, not months. Production-ready templates with built-in CI/CD, evaluation, and observability.
★ 6,336Pythonupdated 2026-04-17agentsgcpgeminigenai-agentsgenerative-ai
Multi-Agent Collaboration Platform✨
★ 303TypeScriptupdated 2026-01-27agentaichatbotmulti-agent
Autonomous GPT-4 agent platform
★ 1,042Pythonupdated 2026-01-01aigpt-4openaipython
Agent driven automation starting with the web. Try it: https://www.emergence.ai/web-automation-api
★ 1,236Pythonupdated 2026-04-17
AI Agent for Twitter Personality Analysis
★ 1,440TypeScriptupdated 2025-01-26
An LLM-powered autonomous agent platform
★ 1,427TypeScriptupdated 2025-05-27
A collection of links to a few AI "deep research" projects and agents, April 2025
★ 1updated 2025-04-05
Standard Schema to JSON Schema convertor
★ 44TypeScriptupdated 2025-09-27
From the team behind Gatsby, Mastra is a framework for building AI-powered applications and agents with a modern TypeScript stack.
★ 23,325TypeScriptupdated 2026-04-20agentsaichatbotsevalsjavascript
Specification and documentation for the Model Context Protocol
★ 7,928TypeScriptupdated 2026-04-20
Fair-code workflow automation platform with native AI capabilities. Combine visual building with custom code, self-host or cloud, 400+ integrations.
★ 185,610TypeScriptupdated 2026-04-20aiapisautomationclidata-flow
K8s-mcp-server is a Model Context Protocol (MCP) server that enables AI assistants like Claude to securely execute Kubernetes commands. It provides a bridge between language models and essential Kubernetes CLI tools including kubectl, helm, istioctl, and argocd, allowing AI systems to assist with cluster management, troubleshooting, and deployments
★ 208Pythonupdated 2026-02-27ai-assistantargocdclaudedevopsdocker
[WIP] Resources for AI engineers. Also contains supporting materials for the book AI Engineering (Chip Huyen, 2025)
★ 15,373Jupyter Notebookupdated 2025-02-12
freeCodeCamp.org's open-source codebase and curriculum. Learn math, programming, and computer science for free.
★ 443,569TypeScriptupdated 2026-04-20careerscertificationcommunitycurriculumd3
An Open Source Machine Learning Framework for Everyone
★ 194,883C++updated 2026-04-20deep-learningdeep-neural-networksdistributedmachine-learningml
Automatically generates beautiful and easy-to-read ER diagrams from your database.
★ 4,775TypeScriptupdated 2026-04-20data-visualizationdatabasedatabase-schemadocumentationdocumentation-tool
★ 495JavaScriptupdated 2024-06-28
Welcome to Cinemate.ai - Your ultimate AI-powered movie recommendation engine! Leveraging the power of AI, LangChain, and the extensive IMDb database, Cinemate.ai delivers personalized movie recommendations tailored to your preferences. Whether you're in the mood for a classic film, the latest blockbuster, or a hidden gem.
★ 2Pythonupdated 2024-08-13agentaiimdb-webscrappinglangchainpython
OpenAPI Tool Servers
★ 936Pythonupdated 2025-09-25aimcpopenapi
★ 353TypeScriptupdated 2025-11-14
MCP server for Israel Government Data
★ 142Pythonupdated 2026-02-14
★ 11Pythonupdated 2025-02-03
DeepLiterature: A fully open-source intelligent research assistant that integrates search, code execution, link resolution, and information expansion, with multiple tools working together to facilitate scientific research.(DeepLiterature:全流程开源的智能科研助手,集成搜索、代码执行、链接解析和信息拓展,多工具协同助力科学研究。)
★ 104Pythonupdated 2025-03-19
🔭 My open-source implementation of Deep Research using Google’s new Gemini 2.0 Flash model.
★ 14TypeScriptupdated 2025-02-08
A serverless, AI-powered deep research agent built with Cloudflare Workers and Google Gemini 2.5
★ 104TypeScriptupdated 2026-03-15aiai-agentcloudflarecloudflare-workersdeep-research
Deep Research through Multi-Agents, using GraphRAG
★ 86JavaScriptupdated 2025-08-21autogenazuredeep-researchgpt-4ographrag
Do literature review Fast, Simple and Reliable
★ 42Pythonupdated 2025-04-02agentic-aiaideep-researchgeminiliterature-review
Deep research agent to help you find the best GitHub repositories 🕵️!
★ 867Pythonupdated 2026-04-08agentdeep-researchgithub-searchlangchainlanggraph
Python implementation of AI-powered research assistant that performs iterative, deep research on any topic by combining search engines, web scraping, and large language models.
★ 49Pythonupdated 2025-03-22
Researcher Agent to write blog posts/ articles using Amazon Bedrock and websearch.
★ 113Pythonupdated 2026-02-05agentic-aiagentic-workflowai-researcherbedrockdeep-research
★ 39JavaScriptupdated 2025-02-23
★ 322TypeScriptupdated 2026-01-28
Create a plan from a description in minutes
★ 374Pythonupdated 2026-04-19agiaillamaindexmcpollama
Enhanced MCP server for deep web research
★ 85TypeScriptupdated 2025-03-05
Local RAG researcher agent built using Langgraph, DeepSeek R1 and Ollama
★ 140Pythonupdated 2025-02-13ai-agentsdeep-researchdeepseekdeepseek-r1langchain
Deeper Seeker is an simpler OSS version of OpenAI's latest Deep Research feature in ChatGPT.It is an agentic research tool to reason , create multi step tasks , synthesize data from multiple online resources and create neat reports
★ 413Pythonupdated 2025-05-12deepresearchexaopenai
An Agentic Deep Research Assistant similar to Gemini and OpenAI Deep Research
★ 134Pythonupdated 2025-02-27
★ 240Pythonupdated 2025-03-09
MCP Server for Windsurf
★ 13TypeScriptupdated 2025-03-06
Run periodic jobs in PostgreSQL
★ 3,765Cupdated 2026-04-07cronperiodic-jobspostgresqlscheduler
Ollama conversation integration for Home Assistant
★ 152Pythonupdated 2024-06-17aihacshassollama
DATAGEN: AI-driven multi-agent research assistant automating hypothesis generation, data analysis, and report writing.
★ 1,699Pythonupdated 2026-04-18agentaiai-data-analysisartificial-intelligencecode-generation
Like Manus, Computer Use Agent(CUA) and Omniparser, we are computer-using agents.AI-driven local automation assistant that uses natural language to make computers work by themselves
★ 3,903Pythonupdated 2026-04-13agentaicomputerusedeepseekmanus
Samantha OS1 is a conversational AI assistant powered by the Realtime API from OpenAI
★ 186Pythonupdated 2024-12-27agentai-agentopenairealtime-apispeech-to-speech
A playful script to get two AI assistants to converse using OpenAI Assistants API
★ 204Pythonupdated 2023-11-07
Your Automatic Prompt Engineering Assistant for GenAI Applications
★ 2,127Pythonupdated 2024-04-22aiai-experimentsai-toolkitaigcapi
This project is a Streamlit-based web application that leverages OpenAI's Assistants API to provide a ChatGPT-like experience. Users can have real-time conversations with the AI, upload documents to be used as context, and even scrape and convert website content to PDFs to enrich the AI's knowledge base.
★ 118Pythonupdated 2023-11-10
A curated list of awesome AI assistants. Example Telegram bot with all these assistants can be tested on the link below.
★ 1,215HTMLupdated 2023-12-21awesome-aiawesome-gptawesome-gptsawesome-listbots
A hackable AI home assistant platform
★ 1,656Jupyter Notebookupdated 2026-04-13
Build AI assistants that interact with your systems
★ 3,275Goupdated 2026-04-10
★ 2,204Pythonupdated 2026-03-09
OpenAI + LINE + Vercel = GPT AI Assistant
★ 7,744JavaScriptupdated 2024-07-09
Open Source Deep Research Alternative to Reason and Search on Private Data. Written in Python.
★ 7,784Pythonupdated 2025-11-19agentagentic-ragclaudedeep-researchdeepseek
An open-source alternative to OpenAI and Gemini's deep research.
★ 880TypeScriptupdated 2025-02-12
Keep searching, reading webpages, reasoning until it finds the answer (or exceeding the token budget)
★ 5,157TypeScriptupdated 2025-12-13deepresearchdeepsearch
Open Source multi-modal LLM environment. Host your own web and mobile chat interface, powered by real-time bots and voice AI functionality.
★ 53TypeScriptupdated 2025-10-14
RAG (Retrieval Augmented Generation) Framework for building modular, open source applications for production by TrueFoundry
★ 4,409Pythonupdated 2026-03-13agentaiapplicationdatadeep-learning
😎 Awesome list of Retrieval-Augmented Generation (RAG) applications in Generative AI.
★ 1,170updated 2026-04-11artificial-intelligencegenerative-ailarge-language-modelsmachine-learningretrieval-augmented-generation
A curated list of retrieval-augmented generation (RAG) in large language models
★ 379updated 2025-12-01awesome-listawesome-resourcesembeddingslarge-language-modelsllm
GitQlient: Multi-platform Git client written with Qt.
★ 883C++updated 2026-04-19cppgitgit-clientqtqt6
Git Source Code Mirror - This is a publish-only repository but pull requests can be turned into patches to the mailing list via GitGitGadget (https://gitgitgadget.github.io/). Please follow Documentation/SubmittingPatches procedure for any of your improvements.
★ 60,566Cupdated 2026-04-18chacktoberfestshell
Perform operations on git repositories in bulk
★ 10JavaScriptupdated 2023-01-11
The GitButler version control client, backed by Git, powered by Tauri/Rust/Svelte
★ 20,662Rustupdated 2026-04-20gitgithubtauri
Find secrets with Gitleaks 🔑
★ 26,291Goupdated 2026-03-25ai-poweredci-cdcicdclidata-loss-prevention
A command-line tool that makes git easier to use with GitHub.
★ 22,945Goupdated 2024-02-02gitgithub-apigohomebrewpull-request
Git with a cup of tea! Painless self-hosted all-in-one software development service, including Git hosting, code review, team collaboration, package registry and CI/CD
★ 55,106Goupdated 2026-04-20bitbucketcicddevopsdocker-registry-v2git
Gogs is a painless self-hosted Git service
★ 47,495Goupdated 2026-04-16dockergitgogogsmysql
Manage many git repos with sanity 从容管理多个git库
★ 1,851Pythonupdated 2026-03-31clicommand-linecommand-line-tooldeveloper-toolsgit
Windows/macOS/Linux GUI client for GIT users
★ 5,006C#updated 2026-04-20cross-platformgitgit-guigui
Local Deep Research achieves ~95% on SimpleQA benchmark (tested with GPT-4.1-mini). Supports local and cloud LLMs (Ollama, Google, Anthropic, ...). Searches 10+ sources - arXiv, PubMed, web, and your private documents. Everything Local & Encrypted.
★ 4,381Pythonupdated 2026-04-20academiaanthropicarxivbravedeep-research
★ 2,764Jupyter Notebookupdated 2025-05-02
Fully local web research and report writing assistant
★ 9,067Pythonupdated 2026-04-12
The official Python SDK for Model Context Protocol servers and clients
★ 22,773Pythonupdated 2026-04-16
[DEPRECATED] Superseded by systempromptio/systemprompt-template and systempromptio/systemprompt-core. Multi-modal MCP client for voice-powered agentic workflows.
★ 210TypeScriptupdated 2025-02-03geminimcpmodel-context-protocolvoice-assistant
This an Model Context Protocol (MCP) server that integrates Notion into your AI workflows. This server enables seamless access to Notion through MCP, allowing AI agents to interact with pages, databases, and comments.
★ 26TypeScriptupdated 2025-02-18aimcpmcp-serversystemprompt
Researching use cases for LLMs using Sefaria's data
★ 4updated 2024-10-15
★ 18Pythonupdated 2023-12-26
makes the jewish library accessible to LLMs through the MCP protocol
★ 22Pythonupdated 2025-04-17aijudaismllm
Fetch and read Jewish texts through the API of Sefaria.org
★ 33Pythonupdated 2025-06-17
Home automation projects that are relevant to people in Israel or Jews generally (e.g. Shabbat and zmanim time integrations)
★ 5updated 2024-04-12
My home assistant tinkering including shabbat mode
★ 1updated 2023-10-05
Converts Sefaria-Export to SQL database
★ 28Javaupdated 2019-01-27
Sefaria for iOS and Android
★ 40JavaScriptupdated 2026-04-16torah
Source files, scripts and data imported to Sefaria.
★ 94HTMLupdated 2026-01-20
Python zmanim library
★ 42Pythonupdated 2023-11-10
Jewish Zmanim Framework (Port of Java Zmanim project by KosherJava)
★ 37C#updated 2023-08-10
KosherJava Zmanim API / Library
★ 129Javaupdated 2026-04-20calendarsdaf-yomidawnduskhebrew-calendar
A bot for Telegram messenger that provides all features of Jewish calendar. Powered by Aiogram.
★ 21Pythonupdated 2024-05-21aiogramhacktoberfestjewishtelegram-botzmanim
Model Context Protocol extension for Hebrew calendar
★ 6TypeScriptupdated 2026-04-16
Tool for scraping and consolidating documentation websites into a single MD file.
★ 259JavaScriptupdated 2026-01-06
The Simple Agent Development Kit.
★ 1,319Pythonupdated 2025-08-23adkagent-based-modelingagent-development-kitagentsai
MCP-Hub and -Inspector, Multi-Model Workflow and Chat Interface
★ 588TypeScriptupdated 2025-08-31
A Model Control Protocol (MCP) server that allows Claude to communicate with locally running LLM models via LM Studio.
★ 151Pythonupdated 2026-04-10
A desktop application that adds powerful tools to Claude and AI platforms
★ 166TypeScriptupdated 2025-02-19aiclaudemcpmodel-context-protocoltools
★ 91Pythonupdated 2024-12-25
An integration that allows LLMs to interact with Raindrop.io bookmarks using the Model Context Protocol (MCP).
★ 72TypeScriptupdated 2025-06-04modelcontextprotocolraindrop-io
mcp-difyworkflow-server is an mcp server Tools application that implements the query and invocation of Dify workflows, supporting the on-demand operation of multiple custom Dify workflows.
★ 59Goupdated 2024-12-26aimcpmcp-server
An MCP server that installs other MCP servers for you
★ 1,521JavaScriptupdated 2024-11-26
A Model-Context Protocol Server for YouTube
★ 515JavaScriptupdated 2025-03-20
MCP server that gives Claude ability to use OpenAI's GPTs assistants
★ 37Pythonupdated 2025-09-12
A Model Context Protocol (MCP) server that helps read GitHub repository structure and important files.
★ 306Pythonupdated 2025-01-26gitllmmcpmodel-context-protocol
Model Context Protocol server that integrates AgentQL's data extraction capabilities.
★ 161Shellupdated 2026-04-14agentagentqlaiaiagentclaude
MCP server for connecting agentic systems to search systems via searXNG
★ 117Pythonupdated 2025-02-21
★ 209Pythonupdated 2025-03-25
mcp server of tavily
★ 9JavaScriptupdated 2025-02-24
A powerful MCP server for Google search that enables parallel searching with multiple keywords simultaneously.
★ 260TypeScriptupdated 2025-06-14google-searchmcpplaywright
MCP Server for SearXNG
★ 718TypeScriptupdated 2026-04-05aillmllm-agentmcpmcp-server
【Star-crossed coders unite!⭐️】Model Context Protocol (MCP) server implementation providing Google News search capabilities via SerpAPI, with automatic news categorization and multi-language support.
★ 122TypeScriptupdated 2026-03-30aiclaudeclaude-desktopgoogle-news-apimcp
Tool to work with arXiv, provide LLM with ability to search and read papers from there
★ 191Pythonupdated 2026-02-19
★ 645Pythonupdated 2026-03-24
A connector for Claude Desktop to work with collection and sources on your Zotero Cloud.
★ 158TypeScriptupdated 2025-02-04
An MCP server implementation that provides tools for retrieving and processing documentation through vector search, enabling AI assistants to augment their responses with relevant documentation context.
★ 259TypeScriptupdated 2025-07-18llmmcpmcp-serversragvector-database
A Model Context Protocol server for converting almost anything to Markdown
★ 2,605TypeScriptupdated 2026-04-17aianthropicanthropic-aianthropic-claudemarkdown
OpenAPI specification MCP server.
★ 85TypeScriptupdated 2025-03-30clinecursormcp-serveropenapiswagger
Model Context Protocol (MCP) Server for Langfuse Prompt Management. This server allows you to access and manage your Langfuse prompts through the Model Context Protocol.
★ 161TypeScriptupdated 2025-02-16langfusellmllmopsmcpmodel-context-protocol
Convert Any OpenAPI V3 API to MCP Server
★ 603Goupdated 2025-04-03agentsmcpmcp-server
Model Context Protocol server to allow for reading and writing from Pinecone. Rudimentary RAG
★ 148Pythonupdated 2025-01-31claudemcpmcp-servermodel-context-protocolpinecone
An official Qdrant Model Context Protocol (MCP) server implementation
★ 1,366Pythonupdated 2026-03-31claudecursorllmmcpmcp-server
🍃🔎 MongoDB Lens: Full Featured MCP Server for MongoDB Databases
★ 201JavaScriptupdated 2025-04-23aiclaudedatabasellmmcp
Connect ClickHouse to your AI assistants.
★ 761Pythonupdated 2026-04-17
Query MCP enables end-to-end management of Supabase via chat interface: read & write query executions, management API support, automatic migration versioning, access to logs and much more.
★ 818Pythonupdated 2025-09-26cursormodel-context-protocolsupabasewindsurf
Connect any Open Data to any LLM with Model Context Protocol.
★ 150Pythonupdated 2024-12-20llmmcpopen-data
MCP Server to interact with Google Gsuite prodcuts
★ 486Pythonupdated 2025-04-14
WhatsApp MCP server
★ 5,554Goupdated 2025-07-13aimcpwhatsappwhatsapp-api
The world's best AI personal assistant for email. Open source app to help you reach inbox zero fast.
★ 10,536TypeScriptupdated 2026-04-20aiemailgmailloopsnextjs
★ 3,656TypeScriptupdated 2026-03-31
Web search using free google search (NO API KEYS REQUIRED)
★ 447JavaScriptupdated 2024-12-30
Playwright Model Context Protocol Server - Tool to automate Browsers and APIs in Claude Desktop, Cline, Cursor IDE and More 🔌
★ 5,465TypeScriptupdated 2025-12-13
Allow LLMs to control a browser with Browserbase and Stagehand
★ 3,286TypeScriptupdated 2026-03-31aibrowserchromechromiummcp
Browse the web, directly from Cursor etc.
★ 819Pythonupdated 2025-07-10browserbrowser-usecursormcpmcp-server
MCP server for browser automation using Playwright
★ 287JavaScriptupdated 2025-06-05
MCP server integration for DaVinci Resolve
★ 889Pythonupdated 2026-03-16blackmagicblackmagic-designblackmagicdesigndavinci-resolvedavinciresolve
A collection of MCP servers
★ 266updated 2025-03-30
MCP Server with TMDB
★ 70JavaScriptupdated 2026-03-27
A simple, secure MCP-to-OpenAPI proxy server
★ 4,157Pythonupdated 2026-02-27mcpmcp-servermcp-to-openapiopen-webuiopenapi
A Model Context Protocol (MCP) server that provides tools for fetching and analyzing Reddit content.
★ 395Pythonupdated 2025-05-11llmmcpmodel-context-protocolreddit
An #OSINT Framework to perform various recon techniques on Companies, People, Phone Number, Bitcoin Addresses, etc., aggregate all the raw data, and give data in multiple formats.
★ 3,276Pythonupdated 2025-11-20
AI Agent which deep crawls a company website and generates a comprehensive PDF report.
★ 22HTMLupdated 2025-02-14
Open-source clone of OpenAI's Deep Research. Works with any transformer, gpt4free, & runs in browser. No Firecrawl needed.
★ 12JavaScriptupdated 2025-06-12agentsaideep-researchdeepresearchllama
An AI-powered solution that automates multi-step research processes, mimicking the work of a seasoned research analyst.
★ 8Pythonupdated 2025-04-09aideep-research
Codebase exploration with AI research agents
★ 18TypeScriptupdated 2025-02-25
An open source deep research clone. AI Agent (Local LLM or Gemini) that reasons large amounts of web data extracted with SwiftSoup.
★ 13Swiftupdated 2025-02-10
DeepSeekDeepResearch is a Python-based AI assistant that leverages a local LLM (DeepSeek-R1:7b via Ollama), the Google Custom Search API, and asynchronous web scraping to automatically gather and refine information on any research topic.
★ 9Pythonupdated 2025-02-06
AI-powered deep research tool leveraging web scraping for cost-effective, comprehensive analysis. Open-source and API-cost free!
★ 23HTMLupdated 2025-03-03bing-searchchat-historychatbotcustom-instructionsduck-duck-go
MCP Deep Research Server using Gemini creating a Research AI Agent
★ 70TypeScriptupdated 2025-08-12aiai-agentsai-researchai-research-assistantai-researcher
An agentic company research tool powered by LangGraph and Tavily that conducts deep diligence on companies using a multi-agent framework. It leverages Google's Gemini 2.5 Flash and OpenAI's GPT-5.1 on the backend for inference.
★ 1,703Pythonupdated 2026-04-17agentsaicompanyfinancial-analysisgemini
Open DeepResearch is an application for assisting in research by conducting comprehensive research on any topic.
★ 28Pythonupdated 2025-02-11agentic-aiaideep-researchllmopen-source
ALwrity - AI Digital Marketing Platform. (WIP)
★ 1,000Pythonupdated 2026-04-20ai-content-generationai-content-marketingai-digital-marketingai-seo-toolsai-social-media
Build a powerful Deep Research AI agent like Gemini or ChatGPT. Using Next.js, Vercel AI SDK, and Exa Search API, An intelligent system that generates follow-up questions, crafts optimal search queries, and compiles comprehensive research reports.
★ 158TypeScriptupdated 2026-01-09aiai-agentai-agentschatgptdeep-research
This repo collects research papers that use AI tools and are in the field of scientific research (including computer science, agronomy, chemistry, physics, etc.). We call this method as Deep-Research.
★ 103updated 2025-03-17agentaillmsresearchscience-research
A multi-agent AI research system designed to know what it knows (and doesn't know) when conducting research and creating content.
★ 177Pythonupdated 2025-02-07
"Your Fully-Automated Personal AI Assistant"
★ 1,500Pythonupdated 2025-10-16agentdeep-researchllm
(Supports DeepSeek R1) An AI-powered research assistant that performs iterative, deep research on any topic by combining search engines, web scraping, and large language models.
★ 2,176TypeScriptupdated 2025-08-19agentaifreegptnuxt
Aria is Your AI Research Assistant Powered by GPT Large Language Models
★ 1,692JavaScriptupdated 2025-04-01ai-assistantgptlarge-language-modelsresearch-paperzotero
[NeurIPS2025] "AI-Researcher: Autonomous Scientific Innovation" -- A production-ready version: https://novix.science/chat
★ 5,224Pythonupdated 2025-10-16ai-researcher
An open source deep research clone. AI Agent that reasons large amounts of web data extracted with Firecrawl
★ 6,213TypeScriptupdated 2025-05-07
An autonomous agent that conducts deep research on any data using any LLM providers
★ 26,707Pythonupdated 2026-04-16agentaiautomationdeepresearchllms
Google Research
★ 37,792Jupyter Notebookupdated 2026-04-19aimachine-learningresearch
Open source alternative to Gemini Deep Research. Generate reports with AI based on search results.
★ 2,131TypeScriptupdated 2025-12-15
Use any LLMs (Large Language Models) for Deep Research. Support SSE API and MCP server.
★ 4,568JavaScriptupdated 2026-04-14anthropicdeep-researchdeep-research-apideepresearchdeepseek
Discover Exceptional MCP Servers
★ 299TypeScriptupdated 2026-01-12mcp-servermodelcontextprotocol
ChatMCP is an AI chat client implementing the Model Context Protocol (MCP).
★ 2,192Dartupdated 2025-09-15aichatclientmcpmcp-client
AGiXT is a dynamic AI Agent Automation Platform that seamlessly orchestrates instruction management and complex task execution across diverse AI providers. Combining adaptive memory, smart features, and a versatile plugin system, AGiXT delivers efficient and comprehensive AI solutions.
★ 3,180Pythonupdated 2026-04-20agent-llmagiagixtaiartificial
A modern chat interface for AI agents built with Next.js, Tailwind CSS, and TypeScript.
★ 1,721TypeScriptupdated 2026-04-09agentagnoaichatself-hosted
🐬DeepChat - A smart assistant that connects powerful AI to your personal world
★ 5,738TypeScriptupdated 2026-04-20agentagent-skillsaiai-assistantai-sdk
Python CLI for AI Chat with MCP support
★ 157Pythonupdated 2026-04-18
AI productivity studio with smart chat, autonomous agents, and 300+ assistants. Unified access to frontier LLMs
★ 44,405TypeScriptupdated 2026-04-20agency-agentsai-agentclaude-codecodexopen-cli
5ire is a cross-platform desktop AI assistant, MCP client. It compatible with major service providers, supports local knowledge base and tools via model context protocol servers .
★ 5,180TypeScriptupdated 2026-03-18knowledge-basellmsmcpmcp-clientmodel-context-protocol
This app allows users to take notes by recording and analyze the content using machine learning technology.
★ 7JavaScriptupdated 2019-05-13
Jewish holidays and Hebrew calendar exports as RSS, CSV, and FullCalendar.io objects, and more
★ 19JavaScriptupdated 2026-04-17
a perpetual Jewish Calendar (Java)
★ 10Javaupdated 2014-03-11
A perpetual Jewish Calendar (golang)
★ 19Goupdated 2026-02-20golanghebcalhebrew-calendarjewish-calendarjewish-holidays
Hebcal server-side Node.js for www.hebcal.com and download.hebcal.com
★ 9JavaScriptupdated 2026-04-20
Daily Learning Schedules: Daf Yomi, Mishna Yomi, Nach Yomi, etc.
★ 8JavaScriptupdated 2026-04-10
⛔️ DEPRECATED - a perpetual Jewish Calendar (JavaScript)
★ 126JavaScriptupdated 2022-06-21deprecatedno-maintenance-intendedobsolete
Structured Jewish texts and metadata exported from Sefaria's database.
★ 368Pythonupdated 2026-04-02
Jewish Projects on GitHub
★ 65updated 2023-12-04awesomehacktoberfestjewishjudaism
Structured Jewish texts with free public licenses
★ 2Pythonupdated 2014-05-14
New Interfaces for Jewish Texts
★ 749JavaScriptupdated 2026-04-20jewishtalmudtorah
The interaction control harness for customer-facing AI agents - optimized for building controlled, consistent, and predictable customer interactions with LLMs.
★ 18,021Pythonupdated 2026-04-19ai-agentsai-alignmentcustomer-servicecustomer-successgemini
Please see Documentation at https://openexchangerates.org to find code, examples and libraries for working with the Open Exchange Rates API
★ 120updated 2013-01-08
Notion Desktop is a cross-platform desktop application that allows you to use Notion directly on your computer, making it easier to chat with friends and family while working.
★ 80JavaScriptupdated 2025-08-28canonicaldesktop-applicationelectronjsjavascriptlinux
The Frontend Stack for Agents & Generative UI. React + Angular. Makers of the AG-UI Protocol
★ 30,442TypeScriptupdated 2026-04-20agentagent-nativeagentic-aiagentsai
AgentQL is a suite of tools for connecting your AI to the web. Featuring a query language and Playwright integrations for interacting with elements and extracting data quickly, precisely, and at scale. Includes REST API, Python and JavaScript SDKs, browser debugger.
★ 1,331Shellupdated 2026-04-16agentaiaiagentautomationjavascript
open-source framework for creating and managing simulations populated with AI-powered agents. It provides an intuitive platform for designing complex, interactive environments where agents can act, learn, and evolve.
★ 934Pythonupdated 2025-01-30
AgentLab: An open-source framework for developing, testing, and benchmarking web agents on diverse tasks, designed for scalability and reproducibility.
★ 571Pythonupdated 2026-03-17agentagentsbenchmarkevaluation-frameworklab
This repository provides an advanced Retrieval-Augmented Generation (RAG) solution for complex question answering. It uses sophisticated graph based algorithm to handle the tasks.
★ 1,586Jupyter Notebookupdated 2025-06-17advanced-ragagentgenailangchainlanggraph
A versatile workflow automation platform to create, organize, and execute AI workflows, from a single LLM to complex AI-driven workflows.
★ 550Pythonupdated 2026-04-14agentagiaiartificial-intelligenceclaude
Code repo for "WebArena: A Realistic Web Environment for Building Autonomous Agents"
★ 1,443Pythonupdated 2025-11-26agentnlp
Agent framework and applications built upon Qwen>=3.0, featuring Function Calling, MCP, Code Interpreter, RAG, Chrome extension, etc.
★ 16,178Pythonupdated 2026-03-04
Agent Laboratory is an end-to-end autonomous research workflow meant to assist you as the human researcher toward implementing your research ideas
★ 5,531Pythonupdated 2025-08-20
Clarity AI | AI Image Upscaler & Enhancer - free and open-source Magnific Alternative
★ 5,038Pythonupdated 2025-03-06aiai-artimage-upscaleimage-upscalerimage-upscaling
A MIT-licensed, deployable starter kit for building and customizing your own version of AI town - a virtual town where AI characters live, chat and socialize.
★ 9,767TypeScriptupdated 2026-03-21
A one stop repository for generative AI research updates, interview resources, notebooks and much more!
★ 26,366HTMLupdated 2026-04-19awesomeawesome-listgenerative-aiinterview-questionslarge-language-models
Get your documents ready for gen AI
★ 58,588Pythonupdated 2026-04-17aiconvertdocument-parserdocument-parsingdocuments
21 Lessons, Get Started Building with Generative AI
★ 109,836Jupyter Notebookupdated 2026-04-16aiazurechatgptdall-egenerative-ai
A collection of MCP servers.
★ 85,639updated 2026-04-15aimcp
🚀 The fast, Pythonic way to build MCP servers and clients.
★ 24,853Pythonupdated 2026-04-20agentsfastmcpllmsmcpmcp-clients
AI Voice Assistant: Talk to an AI agent that helps you with event scheduling, contact management, accessing your knowledge base, and web searches using simple voice commands
★ 68Pythonupdated 2024-12-09ai-agentai-speechai-voice-assistantdeepgramgmail
Sharing early versions of Ada, a personal AI Assistant built on OpenAIs Realtime API
★ 719Pythonupdated 2024-10-20
SUSI.AI server backend - the Artificial Intelligence server for personal assistants https://susi.ai
★ 2,527Javaupdated 2021-08-17
Self-hosted AI coding assistant
★ 33,463Rustupdated 2026-03-02aicodegencoding-assistantcoding-languagedeveloper-experience
A collection of agents that use Large Language Models (LLMs) to perform tasks common on our day to day jobs in cyber security.
★ 271Jupyter Notebookupdated 2024-05-07adversary-emulationaicalderacybersecurityinfosec
A dataset of global salaries in AI/ML and Big Data.
★ 27updated 2026-03-01aidata-sciencejobsmachine-learningml
Improve your resumes with Resume Matcher. Get insights, keyword suggestions and tune your resumes to job descriptions.
★ 26,818TypeScriptupdated 2026-04-17applicant-tracking-systematshacktoberfestmachine-learningnatural-language-processing
AI Agents are missing the UI! We're here to change it. Build Business AI Agents for your company: business workflows, API's, bookings, e-commerce, social commerce, b2b, CPQ, intake forms, NPS tests, made-to-order use cases
★ 169TypeScriptupdated 2025-12-08agentaib2bbooking-systemchatbot
The Unified Intent Mediator (UIM) protocol standardizes interactions between AI agents and web services, streamlining how intents are discovered, executed, and managed. It provides a secure and efficient framework, simplifying integration and enabling scalable, autonomous AI-driven applications and workflows.
★ 40HTMLupdated 2025-07-15actionsaiai-agentsaiagentsapi
⚡️AI Cloud OS: Open-source enterprise-level AI knowledge base and MCP (model-context-protocol)/A2A (agent-to-agent) management platform with admin UI, user management and Single-Sign-On⚡️, supports ChatGPT, Claude, Llama, Ollama, HuggingFace, etc., chat bot demo: https://ai.casibase.com, admin UI demo: https://ai-admin.casibase.com
★ 4,503Goupdated 2026-04-26a2aagentagenticagentic-aiagi
Seamlessly integrate state-of-the-art transformer models into robotics stacks
★ 284Pythonupdated 2025-12-16agentsartificial-intelligencediffusionembodiedembodied-agent
Every AI Agent deserves a wallet.
★ 1,212TypeScriptupdated 2026-04-17
The SDK For Browser Agents
★ 22,339TypeScriptupdated 2026-04-19agentsaillmsplaywrightpuppeteer
Use API to call the music generation AI of suno.ai, and easily integrate it into agents like GPTs.
★ 2,858TypeScriptupdated 2026-03-06aimusicsunosuno-aisuno-ai-api
In-depth tutorials on LLMs, RAGs and real-world AI agent applications.
★ 34,110Jupyter Notebookupdated 2026-03-23agentsaillmsmachine-learningmcp
Build autonomous AI agents in Python.
★ 7,836Pythonupdated 2026-04-17agentagent-frameworkautonomous-agentautonomous-agentsclaude
🏝️ OASIS: Open Agent Social Interaction Simulations with One Million Agents.
★ 4,412Pythonupdated 2026-04-17agent-based-frameworkagent-based-simulationai-societiesdeep-learninglarge-language-models
Agentic-RAG explores advanced Retrieval-Augmented Generation systems enhanced with AI LLM agents.
★ 1,582updated 2025-10-20agenticagentic-aiagentic-frameworkagentic-patternagentic-rag
Humanoid Agents: Platform for Simulating Human-like Generative Agents
★ 316Pythonupdated 2024-10-14
An agent that uses OpenAI's Agents SDK to generate new agents
★ 410TypeScriptupdated 2025-09-22
ChatDev 2.0: Dev All through LLM-powered Multi-Agent Collaboration
★ 32,884Pythonupdated 2026-04-07
Generative Agents for video games. Based on Generative Agents: Interactive Simulacra of Human Behavior
★ 760Javaupdated 2023-10-11generative-agents
LLMs in Finance - Generative AI - AI Agents
★ 853Jupyter Notebookupdated 2026-02-23
A simple screen parsing tool towards pure vision based GUI agent
★ 24,684Jupyter Notebookupdated 2026-04-13
AgentSociety: Large-scale Social Simulation to Understand Human Behaviors and Society through LLM-driven Agents
★ 950Pythonupdated 2026-04-15
Conversational voice AI agents
★ 630Pythonupdated 2026-04-20agentic-aiagentsai-agentscartesiaconversational-ai
An Autonomous LLM Agent for Complex Task Solving
★ 8,527Pythonupdated 2024-08-12
GPTeam: An open-source multi-agent simulation
★ 1,715Pythonupdated 2026-04-16agentsaiautogptgpt-4
AutoChain: Build lightweight, extensible, and testable LLM Agents
★ 1,877Pythonupdated 2025-12-16
TypeScript AI platform with AI chat, Autonomous agents, Software developer agents, chatbots and more
★ 1,183TypeScriptupdated 2025-12-22agentic-frameworkagentsai-agentsai-agents-frameworkai-code-review
Daydreams is a set of tools for building agents for commerce
★ 603TypeScriptupdated 2026-03-018004agent-frameworkagent-frameworksagentsai
Awesome things about LLM-powered agents. Papers / Repos / Blogs / ...
★ 2,226updated 2025-04-30awesome-listchatgptembodied-agentembodied-aifoundation-model
A Comprehensive Benchmark to Evaluate LLMs as Agents (ICLR'24)
★ 3,361Pythonupdated 2026-02-08chatgptgpt-4llmllm-agent
The Digital Being Framework for Autonomous Agents
★ 540Pythonupdated 2025-02-26
A template for building web agents with Stagehand on Browserbase
★ 1,929TypeScriptupdated 2026-04-10
IntentKit is an open-source, self-hosted cloud agent cluster that manages a collaborative team of AI agents for you.
★ 6,503Pythonupdated 2026-04-19agent-frameworkagenticaiai-agentai-agent-framework
Build production-ready AI agents in both Python and Typescript.
★ 3,224Pythonupdated 2026-04-08agentsaiai-agentbeeaiframework
The Open Source Memory Layer For Autonomous Agents
★ 2,578Jupyter Notebookupdated 2024-10-22agentsknowledge-graphmemorymultiagent-systemsrag
This Repo Is In Development. It will slowly but surely become one of the most potent repos available for open source AI agent code for n8n and other use cases that I cover in my YouTube videos. Star the repo to support and to stay up-to-date. Book a call with my team if you want AI agent DFY.
★ 360Pythonupdated 2026-04-03agentsaiaiagentaiagentsn8n
A lightweight framework for building LLM-based agents
★ 2,242Pythonupdated 2026-04-20agentgptllmtransformers
Must-read Papers on LLM Agents.
★ 2,984updated 2026-04-17agentagentsawsome-listenvironmentin-context-learning
Superduper: End-to-end framework for building custom AI applications and agents.
★ 5,271Pythonupdated 2025-09-01aichatbotdatadatabasedistributed-ml
The 500 AI Agents Projects is a curated collection of AI agent use cases across various industries. It showcases practical applications and provides links to open-source projects for implementation, illustrating how AI agents are transforming sectors such as healthcare, finance, education, retail, and more.
★ 29,037updated 2026-01-13ai-agentsgenai
Learn Agentic AI using Dapr Agentic Cloud Ascent (DACA) Design Pattern and Agent-Native Cloud Technologies: OpenAI Agents SDK, Memory, MCP, A2A, Knowledge Graphs, Dapr, Rancher Desktop, and Kubernetes.
★ 4,097Jupyter Notebookupdated 2025-10-26a2aagentic-aidaprdapr-pub-subdapr-service-invocation
A repo lists papers related to LLM based agent
★ 2,285Pythonupdated 2025-07-12agentslarge-language-modelsllm-agentpaper-list
Build agents which are controlled by LLMs
★ 1,040Pythonupdated 2025-06-23deep-learninglangchainllmsmachine-learning
The no-code platform for building custom LLM Agents
★ 2,940updated 2024-06-17aiaichatbotchatbotchatbotschatgpt
Pocket Flow: 100-line LLM framework. Let Agents build Agents!
★ 10,466Pythonupdated 2026-03-27agentic-aiagentic-frameworkagentic-workflowagentsai-framework
Open-source, secure environment with real-world tools for enterprise-grade agents.
★ 11,922Pythonupdated 2026-04-17agentaiai-agentai-agentscode-interpreter
AppAgent: Multimodal Agents as Smartphone Users, an LLM-based multimodal agent framework designed to operate smartphone apps.
★ 6,683Pythonupdated 2025-03-19agentchatgptgenerative-aigpt4gpt4v
🐫 CAMEL: The first and the best multi-agent framework. Finding the Scaling Law of Agents. https://www.camel-ai.org
★ 16,793Pythonupdated 2026-04-19agentai-societiesartificial-intelligencecommunicative-aicooperative-ai
Spec-driven development for large codebases
★ 5,351Pythonupdated 2026-04-20agentsai-agentsai-agents-frameworkartificial-intelligencedeveloper-tools
🤖 / 🏪 Agent Index - This is the agent index for LobeChat. It accesses index.json from this repository to display a list of available agents for LobeChat to the agent market.
★ 1,046TypeScriptupdated 2026-03-20agentaiawesomechatgptlobe-chat-agent
This tool has been deprecated. Use Agentic Document Extraction instead.
★ 5,274Pythonupdated 2026-01-29
Working, locally-running, low-cost implementation of Generative Agents: Interactive Simulacra of Human Behavior.
★ 992Jupyter Notebookupdated 2025-01-16autonomous-agentsgenerative-agents
A privacy-first, self-hosted, fully open source personal knowledge management software, written in typescript and golang.
★ 42,990TypeScriptupdated 2026-04-20ankichatgptdeepseekelectronevernote
An open-source, self-hosted personal AI note tool prioritizing privacy, built using TypeScript .
★ 10,128TypeScriptupdated 2026-04-15markdownmemosnextjsnotebookopenai
A minimalist, open source online pastebin where the server has zero knowledge of pasted data. Data is encrypted/decrypted in the browser using 256 bits AES.
★ 8,232PHPupdated 2026-04-18cryptocryptographyencryptedhacktoberfestone-time
simplifies the process of creating and managing LLM workflows.
★ 115Pythonupdated 2024-10-21aillmnlp-librarynlp-machine-learningprompt-engineering
🔍 LangKit: An open-source toolkit for monitoring Large Language Models (LLMs). 📚 Extracts signals from prompts & responses, ensuring safety & security. 🛡️ Features include text quality, relevance metrics, & sentiment analysis. 📊 A comprehensive tool for LLM observability. 👀
★ 984Jupyter Notebookupdated 2024-11-22large-language-modelsmachine-learningnlgnlpobservability
A blazing fast AI Gateway with integrated guardrails. Route to 200+ LLMs, 50+ AI Guardrails with 1 fast & friendly API.
★ 11,450TypeScriptupdated 2026-03-25ai-gatewaygatewaygenerative-aihacktoberfestlangchain
AI Data Vault - A query engine for AI Agents to securely query data from any datasource
★ 39,054Pythonupdated 2026-04-20agentsaianalyticsartificial-inteligencebigquery
Build high-quality LLM apps - from prototyping, testing to production deployment and monitoring.
★ 11,109Pythonupdated 2026-04-20aiai-application-developmentai-applicationschatgptgpt
LlamaIndex is the leading document agent and OCR platform
★ 48,939Pythonupdated 2026-04-16agentsapplicationdatafine-tuningframework
Follow along with my AI Agents Masterclass videos! All of the code I create and use in this series on YouTube will be here for you to use and even build on top of!
★ 3,372Pythonupdated 2025-01-14
[COLM 2024] OpenAgents: An Open Platform for Language Agents in the Wild
★ 4,780Pythonupdated 2024-11-18agentassistant-chat-botscode-generationexecutable-langauge-groundinggpt
A curated list of GPT agents for cybersecurity
★ 6,496updated 2024-07-21agentscybersecurityinfosecllm
Build resilient language agents as graphs.
★ 30,406Pythonupdated 2026-04-19agentsaiai-agentschatgptdeepagents
Build and run agents you can see, understand and trust.
★ 24,347Pythonupdated 2026-04-20agentchatbotlarge-language-modelsllmllm-agent
This repository contains the Hugging Face Agents Course.
★ 28,159MDXupdated 2026-04-17agentic-aiagentscoursehuggingfacelangchain
Autonomous agents for everyone
★ 18,242TypeScriptupdated 2026-04-20agentagenticaiautonomouschatbot
Generative Agents: Interactive Simulacra of Human Behavior
★ 21,186updated 2024-08-05
SearXNG is a free internet metasearch engine which aggregates results from various search services and databases. Users are neither tracked nor profiled.
★ 29,042Pythonupdated 2026-04-17bingbravedegoogleduckduckgogoogle
Open-source, self-hosted note-taking tool built for quick capture. Markdown-native, lightweight, and fully yours.
★ 59,180Goupdated 2026-04-19dockerfossgomarkdownmemo
🪢 Open source LLM engineering platform: LLM Observability, metrics, evals, prompt management, playground, datasets. Integrates with OpenTelemetry, Langchain, OpenAI SDK, LiteLLM, and more. 🍊YC W23
★ 26,083TypeScriptupdated 2026-04-20analyticsautogenevaluationlangchainlarge-language-models
The open-source LLMOps platform: prompt playground, prompt management, LLM evaluation, and LLM observability all in one place.
★ 4,060TypeScriptupdated 2026-04-20agentsevaluationllm-as-a-judgellm-evaluationllm-framework
UpTrain is an open-source unified platform to evaluate and improve Generative AI applications. We provide grades for 20+ preconfigured checks (covering language, code, embedding use-cases), perform root cause analysis on failure cases and give insights on how to resolve them.
★ 2,344Pythonupdated 2024-08-18autoevaluationevaluationexperimentationhallucination-detectionjailbreak-detection
An awesome & curated list of best LLMOps tools for developers
★ 5,746Shellupdated 2026-04-06ai-development-toolsawesome-listllmopsmlops
TickTick module for custom n8n node
★ 81TypeScriptupdated 2026-02-28automationn8nn8n-community-node-packageticktickworkflow
AIHawk aims to easy job hunt process by automating the job application process. Utilizing artificial intelligence, it enables users to apply for multiple jobs in a tailored way.
★ 29,714Pythonupdated 2025-11-16agentapplication-resumeartificial-intelligenceautomateautomation
Build Real-Time Knowledge Graphs for AI Agents
★ 25,389Pythonupdated 2026-04-18agentsgraphllmsrag
A customisable 3D platform for agent-based AI research
★ 7,353Cupdated 2023-01-04artificial-intelligencedeep-learningmachine-learningneural-networks
The first open-source harness builder for AI coding. Make AI coding deterministic and repeatable.
★ 19,744TypeScriptupdated 2026-04-20aiautomationbunclaudecli
PraisonAI 🦞 — Hire a 24/7 AI Workforce. Stop writing boilerplate and start shipping autonomous agents that research, plan, code, and execute tasks. Deployed in 5 lines of code with built-in memory, RAG, and support for 100+ LLMs.
★ 6,986Pythonupdated 2026-04-20agentsaiai-agent-frameworkai-agent-sdkai-agents
Large Action Model framework to develop AI Web Agents
★ 6,326Pythonupdated 2025-01-21aibrowserlarge-action-modelllmoss
an ambient intelligence library
★ 6,144Pythonupdated 2026-04-17agentsaiambient-aichatbotsgpt
Python SDK for Agent AI Observability, Monitoring and Evaluation Framework. Includes features like agent, llm and tools tracing, debugging multi-agentic system, self-hosted dashboard and advanced analytics with timeline and execution graph view
★ 16,142Pythonupdated 2026-02-11agentic-aiagentic-ai-developmentagentneoagentsai-agent-monitoring
open-source agentic AI data assistant for the next generation of AI + Data products.
★ 18,604Pythonupdated 2026-04-03agentsbgidatabasedeepseekgpt
Building AI agents, atomically
★ 5,846Pythonupdated 2026-04-18aiartificial-intelligencelarge-language-modellarge-language-modelsllms
Agent Zero AI framework
★ 17,286Pythonupdated 2026-04-14agentaiassistantautonomouslinux
12 Lessons to Get Started Building AI Agents
★ 59,438Jupyter Notebookupdated 2026-04-20agentic-aiagentic-frameworkagentic-ragai-agentsai-agents-framework
50+ tutorials and implementations for Generative AI Agent techniques, from basic conversational bots to complex multi-agent systems.
★ 21,566Jupyter Notebookupdated 2026-04-15agentsaiai-agentsgenailangchain
A framework for building realtime voice AI agents 🤖🎙️📹
★ 10,222Pythonupdated 2026-04-20agentsaiopenaireal-timevideo
分享一些好用的 Dify DSL 工作流程,自用、学习两相宜。 Sharing some Dify workflows.
★ 10,436updated 2026-03-25
FastGPT is a knowledge-based platform built on the LLMs, offers a comprehensive suite of out-of-the-box capabilities such as data processing, RAG retrieval, and visual AI workflow orchestration, letting you easily develop and deploy complex question-answering systems without the need for extensive setup or configuration.
★ 27,833TypeScriptupdated 2026-04-20agentclaudedeepseekllmmcp
An open-source visual programming environment for battle-testing prompts to LLMs.
★ 2,975TypeScriptupdated 2026-04-06aievaluationlarge-language-modelsllmopsllms
Rofi: A window switcher, application launcher and dmenu replacement
★ 15,978Cupdated 2026-04-13application-launchercdmenudmenu-replacementi3
Feature rich application Launcher for Linux
★ 4,430Pythonupdated 2026-04-11gtklauncherlinuxpython
WebCatalog - Run Web Apps Like Real Apps
★ 6JavaScriptupdated 2018-01-28
Fully Local Manus AI. No APIs, No $200 monthly bills. Enjoy an autonomous agent that thinks, browses the web, and code for the sole cost of electricity. 🔔 Official updates only via twitter @Martin993886460 (Beware of fake account)
★ 26,085Pythonupdated 2026-04-11agentic-aiagentsaiautonomous-agentsdeepseek-r1
The best way to get AI coding agents to solve hard problems in complex codebases.
★ 10,592TypeScriptupdated 2026-03-07agentsaiampclaude-codecodex
Multi-agent system that automates Gmail inbox management: categorizes emails, applies labels, and generates contextual responses using CrewAI
★ 187Pythonupdated 2025-03-07aiaiagentsaiagentsframeworkautomationcrewai
Rich-text editor with AI and shadcn/ui
★ 16,197TypeScriptupdated 2026-04-16aimcpreactshadcn-uislate
AiEditor is a next-generation rich text editor for AI.
★ 1,744TypeScriptupdated 2026-03-14aieditorcontenteditableeditormarkdown-editorprosemirror
★ 28HTMLupdated 2025-02-11agentsaitwilio
Superinterface is an AI assistants library for building AI capabilities into your app or website. You use React components and hooks to build AI-first assistants-based interfaces like chats and wizards.
★ 334TypeScriptupdated 2026-04-19
An AI-powered research assistant that performs iterative, deep research on any topic by combining search engines, web scraping, and large language models. The goal of this repo is to provide the simplest implementation of a deep research agent - e.g. an agent that can refine its research direction overtime and deep dive into a topic.
★ 18,812TypeScriptupdated 2026-04-11agentaigpto3-miniresearch
Social and customizable AI writing assistant! ✍️
★ 265TypeScriptupdated 2026-04-07aigeminigemini-progptgpt-4
Manifold is an experimental platform for enabling long horizon workflow automation using teams of AI assistants.
★ 489Goupdated 2026-04-19agentsai-agentsai-assistantai-toolsartificial-intelligence
Learn to build your Second Brain AI assistant with LLMs, agents, RAG, fine-tuning, LLMOps and AI systems techniques.
★ 2,663Jupyter Notebookupdated 2026-04-06agentsai-systemsdata-engineeringfine-tuninghuggingface
:tiger: Sara - the Rasa Demo Bot: An example of a contextual AI assistant built with the open source Rasa Stack
★ 992Pythonupdated 2025-02-27conversation-driven-development
A delightfully minimal, yet remarkably powerful AI Shell Assistant.
★ 463Goupdated 2025-08-16
AI Voice Assistant project
★ 46CSSupdated 2025-04-02
Your personal free-to-use AI assistant, built with gemini & flutter.
★ 231Dartupdated 2025-02-24embeddingsfluttergeminihive
Easy to use, scalable admin portal for deploying and managing AI Assistants
★ 32TypeScriptupdated 2024-07-02aichatgptgoogle-gemini-aigoogle-gemini-proopenai
Agentic AI platform that harnesses Visual LLM Chaining to build proactive digital assistants
★ 275Pythonupdated 2026-04-16botbot-frameworkbotkitbotschatbot
Custom AI agent platform to speed up your work.
★ 1,332TypeScriptupdated 2026-04-20agentslarge-language-modelsllmrust
🧠 Leon is your open-source personal assistant.
★ 17,188TypeScriptupdated 2026-04-19aiai-assistantartificial-intelligenceassistantautomation
A command-line personal assistant that integrates with Google Calendar, Gmail, and Tasks to help manage your digital life.
★ 130Pythonupdated 2025-09-18chatbotclaude-3-5-sonnetllmopenrouter
All-in-one LLM CLI tool featuring Shell Assistant, Chat-REPL, RAG, AI Tools & Agents, with access to OpenAI, Claude, Gemini, Ollama, Groq, and more.
★ 9,887Rustupdated 2026-02-23aiai-agentschatbotclaudecli
Self-hosted version of OpenAI’s new stateful Assistants API
★ 550TypeScriptupdated 2025-03-22assistantsgptsopenaiopenai-apiself-hosted
Witsy: desktop AI assistant / universal MCP client
★ 1,948TypeScriptupdated 2026-04-09anthropicdeepseekelectron-appelectronjsgemini
Ray is an AI compute engine. Ray consists of a core distributed runtime and a set of AI Libraries for accelerating ML workloads.
★ 42,311Pythonupdated 2026-04-20data-sciencedeep-learningdeploymentdistributedhyperparameter-optimization
Train your AI self, amplify you, bridge the world
★ 15,473Pythonupdated 2025-09-30
Oliva Multi-Agent Assistant
★ 387Pythonupdated 2025-04-11
BondAI is an open-source tool for developing AI Agent Systems. BondAI handles the implementation complexities including memory/context management, error handling, vector/semantic search and includes a powerful set of out of the box tools and integrations.
★ 219Pythonupdated 2024-01-14
AIlice is a fully autonomous, general-purpose AI agent.
★ 1,405Pythonupdated 2025-08-18agentaillmllm-agent
The open alternative to Salesforce, designed for AI.
★ 45,197TypeScriptupdated 2026-04-20crmcrm-systemcustomergood-first-issuegraphql
Open-source Back-end, self-hostable & ready to use - Real-time, storage, advanced search - Web, Apps, Mobile, IoT -
★ 1,641JavaScriptupdated 2026-04-14api-serverbackendelasticsearchhacktoberfestiot
The open-source visual AI programming environment and TypeScript library
★ 4,545TypeScriptupdated 2026-03-20aillmopenaitypescript
A collection of the most important Github repos for ML, AI & Data science practitioners
★ 988updated 2024-12-24
Amica is an open source interface for interactive communication with 3D characters with voice synthesis and speech recognition.
★ 1,492TypeScriptupdated 2025-07-23aiassistant-chat-botscomputer-visionllmspeech-recognition
Use your locally running AI models to assist you in your web browsing
★ 7,826TypeScriptupdated 2026-04-19chat-applicationchrome-extensionlocalllmollamaopen-source
An LLM playground you can run on your laptop
★ 6,357TypeScriptupdated 2026-02-06
Run frontier AI locally.
★ 44,096Pythonupdated 2026-04-20
Self-hosted web UI for Qdrant
★ 392JavaScriptupdated 2026-04-20
Open source conversation framework for structured Pipecat dialogues
★ 578Pythonupdated 2026-04-17aiconversational-aireal-time
Get up and running with the Gemini API using Node.js and Python
★ 197JavaScriptupdated 2026-04-14geminigemini-api
This SDK is now deprecated, use the new unified Google GenAI SDK.
★ 2,289Pythonupdated 2025-12-16
Examples and guides for using the Gemini API
★ 17,088Jupyter Notebookupdated 2026-04-20geminigemini-api
A react-based starter app for using the Live API over websockets with Gemini
★ 2,530TypeScriptupdated 2026-04-15geminigemini-api
Open Source framework for voice and multimodal conversational AI
★ 11,559Pythonupdated 2026-04-17aichatbot-frameworkchatbotsreal-timevoice
A browser extension for automating your browser by connecting blocks
★ 21,240Vueupdated 2026-03-02automationbrowser-automationbrowser-extensionchrome-extensionfirefox-extension
Curated list of awesome browser automation tools and resources
★ 603updated 2026-03-23automationawesomeawesome-listbrowserlist
A flexible event/agent & automation system with lots of bees 🐝
★ 6,476Goupdated 2023-02-25automationevent-drivenhacktoberfestiftttworkflow
A curated list of awesome open source workflow engines
★ 7,779updated 2026-04-06
command line management for Google Workspace
★ 4,149Pythonupdated 2026-04-16gamgooglegoogle-admin-sdkgoogle-apigoogle-apps
A lightweight, powerful framework for multi-agent workflows
★ 25,199Pythonupdated 2026-04-20agentsaiframeworkllmopenai
agentUniverse is a LLM multi-agent framework that allows developers to easily build multi-agent applications.
★ 2,212Pythonupdated 2026-04-01agentaiai-agentsautonomousawesome
Free & Opensource Laravel CRM solution for SMEs and Enterprises for complete customer lifecycle management.
★ 22,282Bladeupdated 2026-04-19cloudcloudhostingcrmcrm-multi-tenant-saascrm-platform
★ 9,660Jupyter Notebookupdated 2025-10-16
An awesome repository of local AI tools
★ 1,935updated 2024-11-13
Repository of sample applications for https://vespa.ai, the open big data serving engine
★ 405Pythonupdated 2026-04-20
list if cities in israel
★ 10updated 2018-03-05
An alternative mobile client for Israel Railways
★ 183TypeScriptupdated 2026-04-18israelpublic-transportreact-native
Israel Hiking Map has maps, route planning, and travel information for Israel. This repository holds the files needed for running the Israel Hiking Map site and apps.
★ 104TypeScriptupdated 2026-04-20apphacktoberfestmaplibre-gl-jsmapsnavigation
This repo aim to gather all Israelis tech writer, feel free to open Pull Request and add your self❤️
★ 25JavaScriptupdated 2024-06-16
Israel's Ministry of Health's COVID-19 Exposure Prevention App
★ 510TypeScriptupdated 2023-01-26coronaviruscovid-19
A curated list of Israeli product companies/product companies who hire Israelis - who work with Vue JS (Sorted alphabetically)
★ 134updated 2024-07-25
Israeli tech companies map
★ 119updated 2026-04-19
arXiv.org ChatGPT Plugin
★ 5JavaScriptupdated 2023-04-07
Broadlink Manager is a python based project that allows you to contorol your broadlink devices. Discover, Leran and send command in a very easy way
★ 311HTMLupdated 2026-04-12broadlinkbroadlink-devicesbroadlink-rmflaskhome-assistant
Provide scrapers for all major Israeli banks and credit card companies
★ 902TypeScriptupdated 2026-04-16
★ 20JavaScriptupdated 2026-04-13
The personal finance app for everyone
★ 54,093Rubyupdated 2025-07-24financehotwirepersonal-financepostgresqlruby
Collection of handy online tools for developers, with great UX.
★ 38,262Vueupdated 2026-04-16converterdeveloper-productivitydeveloper-toolsfrontendjavascript
Scheduling infrastructure for absolutely everyone.
★ 42,134TypeScriptupdated 2026-04-16next-authnextjsopen-sourcepostgresqlprisma
There can be more than Notion and Miro. AFFiNE(pronounced [ə‘fain]) is a next-gen knowledge base that brings planning, sorting and creating all together. Privacy first, open-source, customizable and ready to use.
★ 67,698TypeScriptupdated 2026-04-20appcrdteditorelectronknowledge-base
Ui.Vision Open-Source RPA Software with Computer Vision, OCR, Anthropic Computer Use/LLM. Selenium IDE import/export.
★ 1,891JavaScriptupdated 2026-03-20anthropicanthropic-claudebrowser-automationbrowser-extensioncomputer-use
A Memento Aggregator CLI and Server in Go
★ 78Goupdated 2026-04-09mementomemento-rfctimemapweb-archiving
** THIS REPO HAS MOVED TO https://github.com/langchain-ai/langchainjs/tree/main/libs/langchain-mcp-adapters ** Adapters for integrating Model Context Protocol (MCP) tools with LangChain.js applications, supporting both stdio and SSE transports.
★ 245TypeScriptupdated 2025-05-16agent-toolsai-toolsjavascriptlangchainlangchainjs
🦜💬 Web app for interacting with any LangGraph agent (PY & TS) via a chat interface.
★ 2,778TypeScriptupdated 2026-04-13agentchatlanggraphllm
A collaborative note taking, wiki and documentation platform that scales. Built with Django and React.
★ 16,444Pythonupdated 2026-04-20blocknotejscollaborativedjangodocumentationg2g
A local-first personal finance app
★ 26,080TypeScriptupdated 2026-04-20budgetingfinancemoneypersonal-finance
Firefly III: a personal finances manager
★ 23,070PHPupdated 2026-04-20accountingbudgetbudgetingbudgetscash-flow
Cross-Platform app for Vikunja
★ 528Dartupdated 2026-04-13flutterto-dovikunja
Containerized Mopidy MPD (Music Player Daemon) along with Spotify, Google Music... plugins.
★ 172Dockerfileupdated 2023-02-08
Git Server with CI/CD, Kanban, and Packages. Seamless integration. Unparalleled experience.
★ 14,889Javaupdated 2026-04-20ci-cddevopsgitkanbanpackages
Convert documents to structured data effortlessly. Unstructured is open-source ETL solution for transforming complex documents into clean, structured formats for language models. Visit our website to learn more about our enterprise grade Platform product for production grade workflows, partitioning, enrichments, chunking and embedding.
★ 14,559HTMLupdated 2026-04-14data-pipelinesdeep-learningdocument-image-analysisdocument-image-processingdocument-parser
Daytona is a Secure and Elastic Infrastructure for Running AI-Generated Code
★ 72,381TypeScriptupdated 2026-04-20agentic-workflowaiai-agentsai-runtimeai-sandboxes
The next generation of SDKMAN! CLI commands, written in Rust
★ 335Rustupdated 2026-03-31
The SDKMAN! Command Line Interface
★ 6,737Shellupdated 2026-03-31
A low-level tool to generate an AppImage from an existing AppDir
★ 363Cupdated 2025-12-04
Package desktop applications as AppImages that run on common Linux-based operating systems, such as RHEL, CentOS, openSUSE, SLED, Ubuntu, Fedora, debian and derivatives. Join #AppImage on irc.libera.chat
★ 9,308Cupdated 2025-06-09appimageapplicationsdeploymentlinuxlinux-app
A LLM project as a part of CS-5660
★ 40updated 2023-12-16
A Python wrapper for the Hunter.io v2 API
★ 133Pythonupdated 2026-04-09
H2O LLM Studio - a framework and no-code GUI for fine-tuning LLMs. Documentation: https://docs.h2o.ai/h2o-llmstudio/
★ 4,914Pythonupdated 2026-04-08aichatbotchatgptfedrampfine-tuning
WebDriver Classic proxy for automating Firefox through Marionette
★ 7,467updated 2025-04-11firefoxgeckogeckodriverrustwebdriver
Visual scraping for Scrapy
★ 9,492Pythonupdated 2024-06-26
Appwrite® - complete cloud infrastructure for your web, mobile and AI apps. Including Auth, Databases, Storage, Functions, Messaging, Hosting, Realtime and more
★ 55,879TypeScriptupdated 2026-04-20androidappwritebackendbackend-as-a-servicedocker
Personal CRM. Remember everything about your friends, family and business relationships.
★ 24,550PHPupdated 2026-03-30crmfamilyfriendshacktoberfestlaravel
The Pinecone Python client
★ 434Pythonupdated 2026-04-08
Weaviate is an open-source vector database that stores both objects and vectors, allowing for the combination of vector search with structured filtering with the fault tolerance and scalability of a cloud-native database​.
★ 16,080Goupdated 2026-04-20approximate-nearest-neighbor-searchgenerative-searchgrpchnswhybrid-search
Qdrant - High-performance, massive-scale Vector Database and Vector Search Engine for the next generation of AI. Also available in the cloud https://cloud.qdrant.io/
★ 30,698Rustupdated 2026-04-20ai-searchai-search-engineembeddings-similarityhnswhybrid-search
Data infrastructure for AI
★ 27,626Rustupdated 2026-04-19agentsaiai-agentsdatabaserust
A curated list of awesome softwares for Devops.
★ 518updated 2025-06-05
A terraform provider that makes it easy to find the resources managed by SUSE inside of different public clouds
★ 11Goupdated 2026-01-08awsazurecloudgceoracle-cloud
AI chat client
★ 249JavaScriptupdated 2025-01-25aiartifactsgemini-prollamamistral
AI agent web app platform
★ 94Pythonupdated 2026-04-16aiai-agentsfastapiframeworkplatform
💬 Typebot is a powerful chatbot builder that you can self-host.
★ 9,883TypeScriptupdated 2026-04-20chat-applicationchatbotconversational-botsform-buildernextjs
Data platform for LLMs - Load, index, retrieve and sync any unstructured data
★ 23Pythonupdated 2024-10-28
😎 Awesome list of tools and projects with the awesome LangChain framework
★ 9,306updated 2026-04-03aiawesomeawesome-listlangchainllm
★ 22,241Pythonupdated 2026-01-31
A collection of autonomous agents 🤖️ powered by LLM.
★ 1,087updated 2026-04-16agentagentsllmllm-powered-agentsmulti-agent
Interactive user interface for CrewAI package.
★ 393TypeScriptupdated 2025-04-11
Build applications that make decisions (chatbots, agents, simulations, etc...). Monitor, trace, persist, and execute on your own infrastructure.
★ 1,978Pythonupdated 2026-04-19aiburrchatbot-frameworkdagsgenerative-ai
AI Agents & MCPs & AI Workflow Automation • (~400 MCP servers for AI agents) • AI Automation / AI Agent with MCPs • AI Workflows & AI Agents • MCPs for AI Agents
★ 21,885TypeScriptupdated 2026-04-20ai-agentai-agent-toolsai-agentsai-agents-frameworkmcp
Automate browser based workflows with AI
★ 21,386Pythonupdated 2026-04-20aiapiautomationbrowserbrowser-automation
Create Custom GPT and add/embed on your site using Assistants api
★ 1,649JavaScriptupdated 2026-02-05aichatbotassistant-apichatbotchatbotschatgpt
UI for the OpenAI API
★ 19TypeScriptupdated 2026-03-24
★ 403updated 2026-03-15
Build and deploy AI Agents on Cloudflare
★ 4,834TypeScriptupdated 2026-04-19agentsaicloudflaredurable-objectsworkflows
🤖 Awesome list of AI Agents
★ 2,229updated 2026-04-18
★ 6,750Rich Text Formatupdated 2025-06-26
Daily Bots Web Demo showcasing how to build real-time voice AI agents 
★ 248TypeScriptupdated 2025-09-10
AI Browser
★ 7,340JavaScriptupdated 2026-04-18
AI agent microservice
★ 3,034Pythonupdated 2026-03-14ag-ui-protocolagentaiassistantchatbot
A personal AI assistant for everyone
★ 680Pythonupdated 2026-04-13agentsartificial-general-intelligenceartificial-intelligenceautomationcontext
Dive is an open-source MCP Host Desktop Application that seamlessly integrates with any LLMs supporting function calling capabilities. ✨
★ 1,779TypeScriptupdated 2026-04-01aiai-agentsllm-interfacellm-uimcp-client
functions etc for openwebui
★ 7Pythonupdated 2026-03-12
★ 4CSSupdated 2025-02-16
Add/remove knowledge from local files/folder.
★ 25Pythonupdated 2025-05-15
⚠️ Archived — BrainDrive is building a new system on personalaiarchitecture.org
★ 43Pythonupdated 2026-03-08
Running Ollama and Open WebUI in a Kubernetes Cluster
★ 14updated 2024-12-02
Personnal collection of pipes and filters I use for open-webui
★ 27Pythonupdated 2026-04-15
A dashboard for tracking user activity and enforcing usage limits in OpenWebUI. Set user quotas efficiently.
★ 520TypeScriptupdated 2026-03-10
Interactive, locally hosted tool to migrate Open-WebUI SQLite databases to PostgreSQL
★ 219Pythonupdated 2025-10-08
Build reliable AI Workflows and Agents with humans in the loop, structured outputs and durable execution.
★ 437TypeScriptupdated 2025-11-24aidurable-executiongolangjavacriptllm
Command-line tools for speech and intent recognition on Linux
★ 1,107Pythonupdated 2024-03-07
Open‑WebUI Tools is a modular toolkit designed to extend and enrich your Open WebUI instance, turning it into a powerful AI workstation. With a suite of over 15 specialized tools, function pipelines, and filters, this project supports academic research, agentic autonomy, multimodal creativity, workflows, and more
★ 681Pythonupdated 2026-04-20academic-researchai-agentsai-workstationarxivcomfyui
Prefect is a workflow orchestration framework for building resilient data pipelines in Python.
★ 22,249Pythonupdated 2026-04-20automationdatadata-engineeringdata-opsdata-science
SoTA production-ready AI retrieval system. Agentic Retrieval-Augmented Generation (RAG) with a RESTful API.
★ 7,775Pythonupdated 2025-11-07artificial-intelligencelarge-language-modelspythonquestion-answeringrag
Weaviate Web UI
★ 79TypeScriptupdated 2023-09-14weaviate
openwebui pipeline to letta agent
★ 11Pythonupdated 2025-01-24
A tool for open-web UI that will search via Exa search
★ 8Pythonupdated 2024-12-03
Deepseek-R1 on modal.com using openwebui and ollama - Quick one command run
★ 6Pythonupdated 2025-01-28
This project implements an asynchronous deep research tool for Open WebUI that performs iterative internet searches using a SearXNG-compatible endpoint.
★ 30updated 2025-07-29
Set of Open WebUI tools
★ 16Pythonupdated 2025-03-10
🤖 A Telegram bot that integrates with OpenWeb UI's OpenAI compatible APIs to provide chat functionality written in Go
★ 17Goupdated 2024-05-26
Create your assistant in the OpenAI dashboard, generate an API key, and use this code to integrate it into Open WebUI. Remember that it is a function, not a pipeline.
★ 15Pythonupdated 2025-01-20
This project sets up an Open WebUI interface with LiteLLM as a backend proxy for AI models. This simple setup makes adding and using various models extremely easy.
★ 47Dockerfileupdated 2024-11-12
通过该项目将Dify通过Pipeline接入OpenwebUI,可以兼并OpenwebUI的前端优势和相应生态以及Dify强大的模型可拓展性和Workflow的效益。
★ 40Pythonupdated 2024-11-28
This repository provides resources and guidelines to facilitate the integration of Open-WebUI and Langfuse, enabling seamless monitoring and management of AI model usage statistics.
★ 68Pythonupdated 2025-05-02dockerdocker-composelangfusellmllm-webui
⚠️ Archived — BrainDrive is building a new system on personalaiarchitecture.org
★ 87Pythonupdated 2026-03-08
GraphRAG4OpenWebUI integrates Microsoft's GraphRAG technology into Open WebUI, providing a versatile information retrieval API. It combines local, global, and web searches for advanced Q&A systems and search engines. This tool simplifies graph-based retrieval integration in open web environments.
★ 595Pythonupdated 2025-01-10aiagentsgraphragllmsollamaopenai
A collection of custom tools and extensions for Open WebUI that enhance its capabilities
★ 12Pythonupdated 2024-12-11aifunctionsllmopen-webuitools
The OpenAPI Specification Repository
★ 30,910Markdownupdated 2026-04-20apisoasopenapiopenapi-specificationrest
🤖 AgentVerse 🪐 is designed to facilitate the deployment of multiple LLM-based agents in various applications, which primarily provides two frameworks: task-solving and simulation
★ 5,022JavaScriptupdated 2024-09-09agentaigptgpt-4llm
Tools for OpenWebUI
★ 174Pythonupdated 2025-05-25agentsaiextensionopenwebuipython
★ 14Jupyter Notebookupdated 2023-06-28
An MCP server that provides LLMs with efficient access to package documentation across multiple programming languages
★ 80TypeScriptupdated 2025-07-18aidocsdocumentationgojavascript
The most powerful and modular diffusion model GUI, api and backend with a graph/nodes interface.
★ 110,102Pythonupdated 2026-04-20aicomfycomfyuipythonpytorch
Use any linux distribution inside your terminal. Enable both backward and forward compatibility with software and freedom to use whatever distribution you’re more comfortable with. Mirror available at: https://gitlab.com/89luca89/distrobox
★ 12,336Shellupdated 2026-04-17almalinuxalpinearchlinuxbashcentos
Generate Multiple Google Docs and PDF from Sheet Data Automatically.
★ 4HTMLupdated 2023-11-01automatic-google-docs-generatorautomatic-pdf-generatorpdfpdf-generator
The fastest implementation of Levenshtein distance in JS/TS.
★ 766TypeScriptupdated 2024-03-17
The usual list of links to interesting resources for Google Apps Script
★ 2,005updated 2026-03-18awesome-listawesome-listsgasgoogle-apps-scriptgoogle-appsscript
Apps Script samples for Google Workspace products.
★ 5,141JavaScriptupdated 2026-04-07adminsdkapps-scriptcalendarclassroomcloud
🌐 The Internet Computer! Free, Open-Source, and Self-Hostable.
★ 40,666JavaScriptupdated 2026-04-20cloudcloud-oscloud-storagedesktopdesktop-environment
★ 2Pythonupdated 2024-04-19
GitHub repository of the Introduction to Machine Learning course in the Hebrew University of Jerusalem. Includes code examples, labs, and exercise templates
★ 51Jupyter Notebookupdated 2025-01-24algorithmsmachine-learningpython3
This is the documentation for Roo Code, an AI-powered autonomous coding agent that lives in your editor.
★ 155TypeScriptupdated 2026-02-19
AI computer use powered by open source LLMs and E2B Desktop Sandbox
★ 1,977Pythonupdated 2025-06-05agentaianthropicclaudecomputer-use
Awesome-LLM: a curated list of Large Language Model
★ 26,695updated 2025-07-31
The open source codebase powering HuggingChat
★ 10,675TypeScriptupdated 2026-04-17chatgpthacktoberfesthuggingfacellmsvelte
Compare open-source local LLM inference projects by their metrics to assess popularity and activeness.
★ 744updated 2025-11-07
Node-based Visual Programming Toolbox
★ 12,688QMLupdated 2026-04-173d-reconstructionalicevisioncamera-trackingcomputer-visionhdr-imaging
A high-throughput and memory-efficient inference and serving engine for LLMs
★ 78,154Pythonupdated 2026-04-20amdblackwellcudadeepseekdeepseek-v3
LocalAI is the open-source AI engine. Run any model - LLMs, vision, voice, image, video - on any hardware. No GPU required.
★ 45,835Goupdated 2026-04-20agentsaiapiaudio-generationdecentralized
LLM inference in C/C++
★ 106,623C++updated 2026-04-20ggml
The python library for research and development in NLP, multimodal LLMs, Agents, ML, Knowledge Graphs, and more.
★ 1,311Pythonupdated 2026-04-20agentsaillmmcpmcp-client
The first real AI developer
★ 33,775Pythonupdated 2026-04-17aicodegencoding-assistantdeveloper-toolsgpt-4
The ultimate space for work and life — to find, build, and collaborate with agent teammates that grow with you. We are taking agent harness to the next level — enabling multi-agent collaboration, effortless agent team design, and introducing agents as the unit of work interaction.
★ 75,654TypeScriptupdated 2026-04-20agentagent-collaborationagent-harnessaichatgpt
★ 29Pythonupdated 2025-07-14
The fastest way to build robust AI agents
★ 2,134Pythonupdated 2025-07-11
AI Agent Framework, the Pydantic way
★ 16,636Pythonupdated 2026-04-20agent-frameworkgenaillmpydanticpython
Educational framework exploring ergonomic, lightweight multi-agent orchestration. Managed by OpenAI Solution team.
★ 21,389Pythonupdated 2026-04-15
beep boop 🤖 (experimental)
★ 118Pythonupdated 2025-01-08botbotsopen-webui
★ 4MDXupdated 2026-04-16
Speech-to-text, text-to-speech with ElevenLabs
★ 35Pythonupdated 2023-12-21elevenlabspyside6pytorchspeech-to-texttext-to-speeh
Two conversational AI agents switching from English to sound-level protocol after confirming they are both AI agents
★ 4,823TypeScriptupdated 2025-07-28
Vapi Blocks is a library of components & api snips to copy and paste into React applications built with TailwindCSS for integrating Voice AI into your application using Vapi.ai. Vapi let's you develop voice AI fast, Vapi Blocks helps you implement faster.
★ 84TypeScriptupdated 2024-12-20aiaudio-visualizerconversational-aimicrophoneuikit
A list of AI coding tools (assistants, completions, refactoring, etc.)
★ 1,650updated 2026-02-23
Knowledge Engine for AI Agent Memory in 6 lines of code
★ 16,781Pythonupdated 2026-04-20aiai-agentsai-memorycognitive-architecturecognitive-memory
The break time reminder app
★ 6,169JavaScriptupdated 2026-04-02breaksbsdelectronlinuxlonger-breaks
🖥️ Run AI Agent in your browser.
★ 15,903Pythonupdated 2025-08-31
LLM supported tools for Homebox storage
★ 6Pythonupdated 2025-03-03
Example of self-hosting n8n in various environments like docker, kubernetes, etc.
★ 1,579Go Templateupdated 2026-04-10
VividNode: Multi-purpose Text & Image Generation Desktop Chatbot (supporting various models including GPT).
★ 151Pythonupdated 2026-04-20aichatbotchatgpt-desktopclaudegemini
🏆 A ranked list of awesome Python open-source libraries and tools. Updated weekly.
★ 4,439updated 2026-04-16awesomeawesome-listbest-ofbest-of-listcli
The AI Toolkit for TypeScript. From the creators of Next.js, the AI SDK is a free open-source library for building AI-powered applications and agents
★ 23,793TypeScriptupdated 2026-04-20anthropicartificial-intelligencegeminigenerative-aigenerative-ui
A programming framework for agentic AI
★ 57,438Pythonupdated 2026-04-15agenticagentic-agiagentsaiautogen
Harness LLMs with Multi-Agent Programming
★ 3,985Pythonupdated 2026-04-07agentsaichatgptfunction-callinggpt
🙌 OpenHands: AI-Driven Development
★ 72,090Pythonupdated 2026-04-20agentartificial-intelligencechatgptclaude-aicli
backblaze b2 command line tool to remove files older than n days.
★ 2Pythonupdated 2022-03-09
Awesome list of 300+ agentic AI resources
★ 1,358Pythonupdated 2025-09-09agentagenticagents
A collection of awesome resources for working with the Windsurf code editor
★ 545JavaScriptupdated 2026-03-03
Integrate cutting-edge LLM technology quickly and easily into your apps
★ 27,786C#updated 2026-04-20aiartificial-intelligencellmopenaisdk
A set of Docker Compose files that allow you to quickly spin up a Graylog instance for testing or demo purposes.
★ 576Shellupdated 2026-03-13
Vane is an AI-powered answering engine.
★ 33,989TypeScriptupdated 2026-04-11ai-agentsai-search-engineanswering-engineartificial-intelligencellm
A Perplexity clone.
★ 1,414TypeScriptupdated 2024-03-28
Docmost is an open-source collaborative wiki and documentation software. It is an open-source alternative to Confluence and Notion.
★ 19,919TypeScriptupdated 2026-04-19confluencedocumentationknowledge-basemediawikinotion
Deprecated; Please use https://github.com/open-webui/desktop instead
★ 183Svelteupdated 2024-05-27open-webui
★ 20updated 2024-11-05
we're cooking
★ 45Jupyter Notebookupdated 2026-03-11
★ 278Go Templateupdated 2026-04-12
Pipelines: Versatile, UI-Agnostic OpenAI-Compatible Plugin Framework
★ 2,354Pythonupdated 2025-08-18open-webui
Flexible and powerful framework for managing multiple AI agents and handling complex conversations
★ 7,587Pythonupdated 2026-04-17agentic-aiagentsai-agentsai-agents-frameworkanthropic
🔥 The API to search, scrape, and interact with the web for AI
★ 112,275TypeScriptupdated 2026-04-20aiai-agentsai-crawlerai-scrapingai-search
Simplify code execution with Open Interpreter UI Project with Streamlit. A user-friendly GUI for Python, JavaScript, and more. Pay-as-you-go, no subscriptions. Ideal for beginners.
★ 222Pythonupdated 2024-03-03
Desktop AI assistant for Linux
★ 8Pythonupdated 2025-02-25
Common interface for interacting with AI agents. The protocol is tech stack agnostic - you can use it with any framework for building agents.
★ 1,461Pythonupdated 2025-04-08agentsaiai-agentapiauto-gpt
Build effective agents using Model Context Protocol and simple workflow patterns
★ 8,291Pythonupdated 2026-01-25agentsaiai-agentsllmllms
Universal AI Agent Frontend. Build your backend we handle the rest.
★ 546TypeScriptupdated 2025-02-06ai-agentsai-agents-frameworkanalyticsauthentication
A curated list of of awesome UI agents resources, encompassing Web, App, OS, and beyond (continually updated)
★ 294updated 2025-12-15
Build, run, manage agentic software at scale.
★ 39,678Pythonupdated 2026-04-20agentsaiai-agentsdeveloper-toolspython
https://docs.openwebui.com
★ 720CSSupdated 2026-04-19open-webui
★ 268Pythonupdated 2025-01-30
Claude Engineer is an interactive command-line interface (CLI) that leverages the power of Anthropic's Claude-3.5-Sonnet model to assist with software development tasks.This framework enables Claude to generate and manage its own tools, continuously expanding its capabilities through conversation. Available both as a CLI and a modern web interface
★ 11,166Pythonupdated 2024-12-12
★ 1,066TypeScriptupdated 2025-12-12
Streaming Availability API allows getting streaming availability information of movies and series; and querying the list of available shows on streaming services such as Netflix, Disney+, Apple TV, Max and Hulu across multiple countries!
★ 56Goupdated 2025-09-08amazon-prime-videoapiapi-clientapple-tvappletv
🌐 Wikipedia for Web APIs. Directory of REST API definitions in OpenAPI 2.0/3.x format
★ 4,438updated 2025-08-28apiapi-catalogapi-directoryawsazure
A visual playground for agentic workflows: Iterate over your agents 10x faster
★ 5,713TypeScriptupdated 2025-07-20agentagentsaibuilderdeepseek
Python 3 JustWatch.com API - https://justwatch.com
★ 346Pythonupdated 2024-05-21cinemamovie
★ 432HTMLupdated 2024-12-11
Client for the Nuclino API
★ 3PHPupdated 2025-02-27apinuclinophp
★ 57Pythonupdated 2026-04-18
Notion API client SDK, rewritten in Python! (sync + async)
★ 2,166Pythonupdated 2026-04-18api-clientasyncdataclasseshttpxnotion
OpenAI Assistants API quickstart with Next.js.
★ 1,965TypeScriptupdated 2025-03-07
This is a simple demonstration of more advanced, agentic patterns built on top of the Realtime API.
★ 6,839TypeScriptupdated 2026-01-07
The open-source repo for docs.dify.ai
★ 528Shellupdated 2025-04-29
Vapi docs
★ 65MDXupdated 2026-04-18
Collection of device converters to be used with zigbee-herdsman
★ 1,177TypeScriptupdated 2026-04-20hacktoberfest
Provides an ICS (icalendar) platform for the Home Assistant calendar
★ 200Pythonupdated 2026-04-13calendarhome-assistanthomeassistantics
A modern Python application packaging and distribution tool
★ 6,097Rustupdated 2024-12-24
The open-source AI-native IDE
★ 2,199TypeScriptupdated 2025-02-25
Curated list of AI-powered developer tools.
★ 3,751updated 2026-04-18
This package lets you start Vapi calls directly in your Python application.
★ 118Pythonupdated 2026-01-31
directory for Awesome MCP Servers
★ 1,997TypeScriptupdated 2025-03-26awesome-mcp-serversmcpmcp-server-storemcp-serversmcp-servers-directory
simple web ui to manage mcp (model context protocol) servers in the claude app
★ 286TypeScriptupdated 2026-02-07claudellmmcpmodel-context-protocolreact
A CLI inspector for the Model Context Protocol
★ 430JavaScriptupdated 2025-08-13
Get your projects MCP (Model Context Protocol) badges
★ 29updated 2025-01-03
An MCP server for Tavily's search API
★ 71Pythonupdated 2025-11-25mcpnewssearchtavilyweb
MCP server for Todoist integration enabling natural language task management with Claude
★ 390JavaScriptupdated 2025-04-20
Allow AI to wade through complex OpenAPIs using Simple Language
★ 889TypeScriptupdated 2026-02-21
A simple MCP server for Obsidian
★ 694TypeScriptupdated 2025-06-23
★ 883TypeScriptupdated 2025-05-14
A MCP server for Home Assistant
★ 568TypeScriptupdated 2026-01-25
A Google Tasks Model Context Protocol Server for Claude
★ 129TypeScriptupdated 2026-03-10
★ 70TypeScriptupdated 2024-12-22
Model Context Protocol (MCP) Server for dify workflows
★ 275Pythonupdated 2025-04-20
Discord MCP Server for Claude Integration
★ 198TypeScriptupdated 2025-01-21
MCP server for Docker
★ 703Pythonupdated 2025-06-05
TS based companion MCP server for the Drupal MCP module that works with the STDIO transport.
★ 50TypeScriptupdated 2025-05-01denodrupalmcpmcp-server
MCP (Model Context Protocol) server for uploading media to Cloudinary using Claude Desktop
★ 10JavaScriptupdated 2025-03-13
★ 79Pythonupdated 2025-12-09
🗂️🤖 Airtable Model Context Protocol Server, for allowing AI systems to interact with your Airtable bases
★ 440TypeScriptupdated 2026-04-11airtablemcp-servermodel-context-protocol
★ 7Pythonupdated 2025-02-03
IrScrutinizer is a program for IR signal analysis, decoding, generation and much more.
★ 490Javaupdated 2025-11-30infraredirir-protocolsir-signalsirp
An LLM-powered knowledge curation system that researches a topic and generates a full-length report with citations.
★ 28,130Pythonupdated 2025-09-30agentic-ragdeep-researchemnlp2024knowledge-curationlarge-language-models
Open Source Invoicing Solution for Individuals & Businesses
★ 8,280PHPupdated 2024-08-10invoicesjavascriptlaravellaravel-frameworkpayment
Control Any Computer Using LLMs.
★ 2,659Pythonupdated 2026-02-25assistantassistant-computer-controlautomationgptgpt4
aider is AI pair programming in your terminal
★ 43,948Pythonupdated 2026-04-09anthropicchatgptclaude-3clicommand-line
Roo Code gives you a whole dev team of AI agents in your code editor.
★ 23,571TypeScriptupdated 2026-04-20
Open-source resources on agents for computer use.
★ 411updated 2025-10-08
An open-source implementation of Anthropic's Computer Use to perform basic tasks using AI Agents.
★ 312Pythonupdated 2024-10-30
A curated list of resources about AI agents for Computer Use, including research papers, projects, frameworks, and tools.
★ 1,652updated 2025-09-26aiai-researchawesomecomputercomputer-use
Agent S: an open agentic framework that uses computers like a human
★ 10,915Pythonupdated 2026-02-21agent-computer-interfaceai-agentscomputer-automationcomputer-usecomputer-use-agent
This is a collection of resources for computer-use GUI agents, including videos, blogs, papers, and projects.
★ 546updated 2026-04-15
Desktop app to control your computer with AI using your terminal, browser, mouse & keyboard
★ 626Rustupdated 2026-01-09aiai-toolsanthropicclaude-3-5-sonnetclaude-4-5-opus
A CLI that converts natural language to shell commands.
★ 5,242TypeScriptupdated 2026-01-05ai
The Self-hosted AI Starter Kit is an open-source template that quickly sets up a local AI environment. Curated by n8n, it provides essential tools for creating secure, self-hosted AI workflows.
★ 14,687updated 2026-01-06aiai-agentslow-codeself-hostedstarter-kit
The premier source of truth powering network automation. Open source under Apache 2. Try NetBox Cloud free: https://netboxlabs.com/products/free-netbox-cloud/
★ 20,338Pythonupdated 2026-04-20cablingdcimdjangoinfrastructure-managementipam
Open WebUI Desktop 🌐
★ 1,542Svelteupdated 2026-04-20appdesktopopen-webui
Rasa UI is a frontend for the Rasa Framework
★ 966JavaScriptupdated 2025-11-12angularmanage-botsnlpnlp-apisnlp-machine-learning
Template repository for version controlling AI assistant configurations (and associated elements like context data)
★ 2Pythonupdated 2025-01-27
Assistant which improves the configuration of assistant configuration texts
★ 1updated 2025-01-27
Kimi.ai Desktop Application (Mac, Windows, and Linux)
★ 63Rustupdated 2024-02-26
DeepSeek-VL2: Mixture-of-Experts Vision-Language Models for Advanced Multimodal Understanding
★ 5,274Pythonupdated 2025-02-26
Traccar Docker
★ 365updated 2026-02-03
DeepSeek-VL: Towards Real-World Vision-Language Understanding
★ 4,091Pythonupdated 2024-04-24foundation-modelsvision-language-modelvision-language-pretraining
This app allows you to post bite-sized tweets summarizing your Hashnode Blog post.
★ 22JavaScriptupdated 2021-09-01auth0hackathonhashnodenextjstailwindcss
Linux Kodachi is a Debian-based security OS by Warith Al Maawali, built for uncompromising privacy, anonymity, and reliability. It pairs hardened defaults with a curated toolkit for private browsing, advanced networking, and incident response, all in an intuitive interface.
★ 477Shellupdated 2026-04-16cyber-securitycybersecuritycybersecurity-educationcybersecurity-toolslinux
Donetick an open-source, user-friendly app for managing tasks and chores, featuring customizable options to help you and others stay organized
★ 2,095Goupdated 2026-04-13choredockergogolangreact
This Home Assistant integration provides a network scanner that identifies all devices on your local network. Utilizing the provided IP range and MAC address mappings, it gives each identified device a user-friendly name and manufacturer information.
★ 204Pythonupdated 2025-08-25custom-componenthome-assistanthomeassistanthomeassistant-integrationnmap
An open-source RAG-based tool for chatting with your documents.
★ 25,310Pythonupdated 2026-04-03chatbotllmsopen-sourcerag
Retrieval Augmented Generation (RAG) chatbot powered by Weaviate
★ 7,663Pythonupdated 2026-04-20
Agent Cloud is like having your own GPT builder with a bunch extra goodies. The GUI features 1) RAG pipeline which can natively embed 260+ datasources 2) Create Conversational apps (like GPTs) 3) Create Multi Agent process automation apps (crewai) 4) Tools 5) Teams+user permissions. Get started fast with Docker and our install.sh
★ 683TypeScriptupdated 2025-07-21aiautogenchatgptcrewaidockerized-application
★ 32Pythonupdated 2026-03-08
Exporter for machine metrics
★ 13,361Goupdated 2026-04-16host-metricsmachine-metricsmetricsnode-metricsprocfs
A Community Open-Source Saas for Crafting/Building/Creating Chatbots with OpenAI's Assistant API that you can add to your website.
★ 422TypeScriptupdated 2024-10-24aiartificial-intelligenceartificial-neural-networksassistantassistant-app
HomeAssistant Linux Companion
★ 84Pythonupdated 2025-11-17
Apprise - Push Notifications that work with just about every platform!
★ 16,432Pythonupdated 2026-04-19alertsappriseframeworknotification-apinotification-hub
Home Assistant custom component of conversation agent. It uses OpenAI to control your devices.
★ 1,380Pythonupdated 2026-04-11conversationcustom-componenthomeassistant
★ 102,899Pythonupdated 2025-08-28
DeepSeek Coder: Let the Code Write Itself
★ 23,121Pythonupdated 2025-11-11
LLM Frontend for Power Users.
★ 26,268JavaScriptupdated 2026-04-19aichatllm
<⚡️> SuperAGI - A dev-first open source autonomous AI agent framework. Enabling developers to build, manage & run useful autonomous agents quickly and reliably.
★ 17,479Pythonupdated 2025-01-22agentsagiaiartificial-general-intelligenceartificial-intelligence
🌟 The Multi-Agent Framework: First AI Software Company, Towards Natural Language Programming
★ 67,426Pythonupdated 2026-01-21agentgptllmmetagptmulti-agent
AIOS: AI Agent Operating System
★ 5,555Pythonupdated 2026-04-15
🌐 Make websites accessible for AI agents. Automate tasks online with ease.
★ 90,325Pythonupdated 2026-04-19ai-agentsai-toolsbrowser-automationbrowser-usellm
Framework for orchestrating role-playing, autonomous AI agents. By fostering collaborative intelligence, CrewAI empowers agents to work together seamlessly, tackling complex tasks.
★ 49,930Pythonupdated 2026-04-20agentsaiai-agentsaiagentframeworkllms
hashnode assets backup
★ 5JavaScriptupdated 2022-12-09
★ 2updated 2026-02-18
Code at the speed of thought – Zed is a high-performance, multiplayer code editor from the creators of Atom and Tree-sitter.
★ 79,791Rustupdated 2026-04-20gpuirust-langtext-editorzed
A simple CLI chatbot that demonstrates the integration of the Model Context Protocol (MCP).
★ 248Pythonupdated 2024-12-05
A collection of MCP clients.
★ 6,399updated 2026-04-14clientsmcp
Customizable browser's home page to interact with your homeserver's Docker containers (e.g. Sonarr/Radarr)
★ 7,129TypeScriptupdated 2026-04-08dashboarddockerhomepagehomeservermantine
An easy way to extract information from documents
★ 1,781Pythonupdated 2023-05-03
File Parser optimised for LLM Ingestion with no loss 🧠 Parse PDFs, Docx, PPTx in a format that is ideal for LLMs.
★ 7,353Pythonupdated 2025-02-21docxllmparserpdfpowerpoint
Interact privately with your documents using the power of GPT, 100% privately, no data leaks
★ 4Pythonupdated 2023-10-03
Open Source AI Platform - AI Chat with advanced features that works with every LLM
★ 28,514Pythonupdated 2026-04-20aiai-chatchatgptchatuienterprise-search
Awesome-RAG: a curated list of Retrieval-Augmented Generation
★ 43TypeScriptupdated 2024-12-31
★ 376updated 2025-09-07ragrag-evaluationrag-implementation
Awesome-LLM-RAG: a curated list of advanced retrieval augmented generation (RAG) in Large Language Models
★ 1,324updated 2026-04-20embeddingslarge-language-modelsllmragrag-embeddings
This repo aims to record resource of role-playing abilities in LLMs, including dataset, paper, application, etc.
★ 141updated 2024-09-23awesome-listllmnlprole-playing
A curated list of personalized Language model / Large language model (continually updated)
★ 10updated 2023-11-17awesome-listconversational-aidialogue-systemsgenerative-modellanguage-model
The open-source hub to build & deploy GPT/LLM Agents ⚡️
★ 14,652TypeScriptupdated 2026-04-17agentaibotpresschatbotchatgpt
100+ AI Agent & RAG apps you can actually run — clone, customize, ship.
★ 107,537Pythonupdated 2026-04-19agentsllmspythonrag
Production-ready platform for agentic workflow development.
★ 139,176TypeScriptupdated 2026-04-20agentagentic-aiagentic-frameworkagentic-workflowai
No-code multi-agent framework to build LLM Agents, workflows and applications with your data
★ 2,291Pythonupdated 2024-12-11agentsaiai-agents-frameworkgenerative-aillm-agents
🤖 Assemble, configure, and deploy autonomous AI Agents in your browser.
★ 36,030TypeScriptupdated 2025-04-29agentagentgptagentsagiai
The Open Assistant API is a ready-to-use, open-source, self-hosted agent/gpts orchestration creation framework, supporting customized extensions for LLM, RAG, function call, and tools capabilities. It also supports seamless integration with the openai/langchain sdk.
★ 362Pythonupdated 2025-06-24agentaiassistantsassistants-apichatgpt
The open source platform for AI-native application development.
★ 5,381Pythonupdated 2024-12-02agentaiai-nativefunction-callgenerative-ai
Superagent protects your AI applications against prompt injections, data leaks, and harmful outputs. Embed safety directly into your app and prove compliance to your customers.
★ 6,556TypeScriptupdated 2026-04-11aianthropicguardrailsllmopenai
Universal memory layer for AI Agents
★ 54,076Pythonupdated 2026-04-20agentsaiai-agentsapplicationchatbots
Build Conversational AI in minutes ⚡️
★ 12,005Pythonupdated 2026-04-09chatgptlangchainllmopenaiopenai-chatgpt
Opiniated RAG for integrating GenAI in your apps 🧠 Focus on your product rather than the RAG. Easy integration in existing products with customisation! Any LLM: GPT4, Groq, Llama. Any Vectorstore: PGVector, Faiss. Any Files. Anyway you want.
★ 39,126Pythonupdated 2025-07-09aiapichatbotchatgptdatabase
Cutting edge AI technology for automated audio transcription. A nice GUI for OpenAIs Whisper and pyannote (speaker identification)
★ 1,876Pythonupdated 2026-04-17audio-transcriptionfaster-whisperinterviewpyannotequalitative-research
RingCentral Embeddable with Electron. Support Linux/Unix (Community)
★ 42JavaScriptupdated 2026-04-03
A Deepgram client for Dart and Flutter, supporting all Speech-to-Text and Text-to-Speech features on every platform.
★ 19Dartupdated 2025-09-12dartdeepgram-apiflutteropen-sourcesdk
Handy voice dictation using whisper.
★ 23Pythonupdated 2026-03-30
Your AI second brain. Self-hostable. Get answers from the web or your docs. Build custom agents, schedule automations, do deep research. Turn any online or local LLM into your personal, autonomous AI (gpt, claude, gemini, llama, qwen, mistral). Get started - free.
★ 34,251Pythonupdated 2026-03-26agentaiassistantchatchatgpt
A key remapping daemon for linux.
★ 5,282Cupdated 2025-12-19ckeyboardkeyboard-layoutkeyboard-mappingkeyboard-remap
The most advanced Web UI for AI chat
★ 898HTMLupdated 2026-03-23chatgptchatgpt-uiclaudeclaude2gemini
Programmable adapter for USB input devices
★ 1,513JavaScriptupdated 2026-04-07
Centralized network visibility and continuous asset discovery. Monitor devices, detect change, and stay aware across distributed networks.
★ 6,268Pythonupdated 2026-04-17arp-scanasset-managementdcimipamnetwork-analysis
Lightweight network IP scanner written in Go. With notifications, history, export to Grafana
★ 6,893Goupdated 2025-09-10arp-scanarp-scannerintrusion-detectionmonitoringnetwork-security
Create web-based user interfaces with Python. The nice way.
★ 15,718Pythonupdated 2026-04-17frontendguiinteractioninterfaceinterfaces
A Web UI for easy subtitle using whisper model.
★ 2,764Pythonupdated 2025-12-29aigradioopen-sourcepythonpytorch
★ 238Cupdated 2023-11-27
NFC for Personal Computers
★ 25Javaupdated 2024-12-17javandefnfcpcsc
Offical FUTO Keyboard Issue Tracker and Source Mirror of https://gitlab.futo.org/keyboard/voiceinput
★ 269Cupdated 2025-09-16androidfutokeyboardofflineprivacy
Official FUTO Keyboard Issue Tracker and Source Mirror of https://gitlab.futo.org/keyboard/latinime
★ 2,381C++updated 2026-04-16androidfutokeyboardofflineprivacy
Get Android app updates straight from the source.
★ 16,708Dartupdated 2026-04-16androidapkapk-updateapk-updaterapp-updater
★ 142JavaScriptupdated 2023-01-13
A robust, efficient, low-latency speech-to-text library with advanced voice activity detection, wake word activation and instant transcription.
★ 9,743Pythonupdated 2026-03-14pythonrealtimespeech-to-text
🔊 Awesome list for Whisper — an open-source AI-powered speech recognition system developed by OpenAI
★ 2,275updated 2026-03-17aiartificial-intelligenceawesomeawesome-listgpt
MovieGPT: A RAG, Gen AI application for Movie Recommendations
★ 38Jupyter Notebookupdated 2024-08-19chatgptlarge-language-modelsllama-indexllmrecommendation-systems
The official Python library for the OpenAI API
★ 30,599Pythonupdated 2026-04-17openaipython
The AI Assistant uses OpenAI's GPT models and Langchain for agent management and memory handling. With a Streamlit interface, it offers interactive responses and supports efficient document search with FAISS. Users can upload and search pdf, docx, and txt files, making it a versatile tool for answering questions and retrieving content.
★ 9Pythonupdated 2024-04-22artificial-intelligencedata-sciencefaisslangchainllms
A natural language interface for computers
★ 63,313Pythonupdated 2026-04-14chatgptgpt-4interpreterjavascriptnodejs
Web UI for training and running open models like Gemma 4, Qwen3.5, DeepSeek, gpt-oss locally.
★ 62,969Pythonupdated 2026-04-20agentdeepseekfine-tuninggemmagemma3
Train and use generative text models in a few lines of code.
★ 20Pythonupdated 2021-12-05gpt-2gpt-3huggingface-transformersnatural-language-generation
Codespaces-based template for working with microsoft/lida
★ 3Jupyter Notebookupdated 2023-10-08
Faster Whisper transcription with CTranslate2
★ 22,404Pythonupdated 2025-11-19deep-learninginferenceopenaiquantizationspeech-recognition
Langflow is a powerful tool for building and deploying AI-powered agents and workflows.
★ 147,367Pythonupdated 2026-04-20agentschatgptgenerative-ailarge-language-modelsmultiagent
A curated list of awesome LLM agents frameworks.
★ 1,445Pythonupdated 2026-04-19agentslangchainllm
The universal tool suite for vector database management. Manage Pinecone, Chroma, Qdrant, Weaviate and more vector databases with ease.
★ 2,213TypeScriptupdated 2025-04-15aiai-agentsaitoolschromadatabase-management
VectorFlow is a high volume vector embedding pipeline that ingests raw data, transforms it into vectors and writes it to a vector DB of your choice.
★ 701Pythonupdated 2024-05-16aidata-engineeringembeddingsmachine-learningnlp
Typescript/React Library for AI Chat💬🚀
★ 9,686TypeScriptupdated 2026-04-20ai-chatbotchatbotconversational-aicopilotradix-ui
Open-source, local-first apps.
★ 4,474TypeScriptupdated 2026-04-19sveltesveltekittailwindcsstauri
Google AI Studio Starter Apps
★ 1,314TypeScriptupdated 2026-04-09aigeminigemini-apigoogle
ModelScope: bring the notion of Model-as-a-Service to life.
★ 8,878Pythonupdated 2026-04-20cvdeep-learningmachine-learningmulti-modalnlp
★ 45updated 2024-07-11
★ 58Pythonupdated 2022-03-18
OpenDAN is an open source Personal AI OS , which consolidates various AI modules in one place for your personal use.
★ 2,022Pythonupdated 2026-03-28agentaiautogptllmopenai
⚡️ 10x - Up to 20x faster AI coding with multi-step Superpowers. Open-source agent with smart model routing, BYOK, fully self-hosted.
★ 1,346TypeScriptupdated 2026-01-05ai-agentsanthropicclaudeclaude-codecodex
Linux-based voice-to-text tool using AI (Whisper/DeepGram) for real-time speech transcription. Command-line interface for easy recording, processing, and text output. Ideal for accessibility, dictation, and hands-free text input in Linux environments.
★ 14Pythonupdated 2025-04-20
A simple GTK4 GUI for PipeWire
★ 94Pythonupdated 2026-03-23gnomegtkgtk4libadwaitapipewire
Your personal, fully customizable, Linux Voice Control Assistant.
★ 190Pythonupdated 2024-02-10aidesktop-voice-controllinuxvoice-control
A simple GUI to use Whisper.
★ 424Pythonupdated 2025-07-18gradioguihuggingfaceinterfacespeech-recognition
Every front-end GUI client for ChatGPT, Claude, and other LLMs
★ 3,975updated 2026-01-22anthropicchatgptclaudegpt-3gpt-4
The code for the paper: "Same Task, More Tokens: the Impact of Input Length on the Reasoning Performance of Large Language Models"
★ 57Jupyter Notebookupdated 2025-10-24
Finetuning and evaluating LLMs to extract GHG emissions from PDF reports using RAG and grammar-based decoding.
★ 5TeXupdated 2024-03-22data-extractionevaluationinformation-extractionllmlong-context
Continuous Integration for LLM powered applications
★ 258Pythonupdated 2023-08-11gptlangchainllmpythontest-automation
[ICLR'25] BigCodeBench: Benchmarking Code Generation Towards AGI
★ 498Pythonupdated 2026-01-03agentagentsbenchmarkchatgptclaude-3
Home of StarCoder2!
★ 2,061Pythonupdated 2024-03-21
👨‍💻 An awesome and curated list of best code-LLM for research.
★ 1,283updated 2024-12-10awesomecode-generationlarge-language-models
Autonomous coding agent right in your IDE, capable of creating/editing files, executing commands, using the browser, and more with your permission every step of the way.
★ 61,004TypeScriptupdated 2026-04-20
Graphical user inferface for local language models
★ 10Vueupdated 2024-05-24
Promptdesk is a tool designed for effectively creating, organizing, and evaluating prompts and large language models (LLMs).
★ 95TypeScriptupdated 2025-08-29javascript-librarylarge-language-modelsllmllm-agentllm-apps
Python SDK, Proxy Server (AI Gateway) to call 100+ LLM APIs in OpenAI (or native) format, with cost tracking, guardrails, loadbalancing and logging. [Bedrock, Azure, OpenAI, VertexAI, Cohere, Anthropic, Sagemaker, HuggingFace, VLLM, NVIDIA NIM]
★ 44,731Pythonupdated 2026-04-20ai-gatewayanthropicazure-openaibedrockgateway
AI suite powered by state-of-the-art models and providing advanced AI/AGI functions. Includes AI personas, AGI functions, world-class Beam multi-model chats, text-to-image, voice, response streaming, code highlighting and execution, PDF import, presets for developers, much more. Deploy on-prem or in the cloud.
★ 6,935TypeScriptupdated 2026-04-20agiai-agentsai-suiteai-workspaceanthropic-api
✨ Light and Fast AI Assistant. Support: Web | iOS | MacOS | Android | Linux | Windows
★ 87,804TypeScriptupdated 2025-12-02calclaudechatgptclaudecross-platformdesktop
Integrate the DeepSeek API into popular software
★ 36,560updated 2026-02-23awesomedeepseek
ID-based RAG FastAPI: Integration with Langchain and PostgreSQL/pgvector
★ 794Pythonupdated 2026-04-20apiapi-restembeddingsfastapilangchain
Curated GPT-Image-2 prompts for the OpenAI API — portraits, posters, UI mockups, game screenshots, character sheets, and more. Ready-to-use prompts for gpt-image-2.
★ 1,692updated 2026-04-23ai-artai-generated-artai-imageapiawesome-list
A curated list of awesome ChatGPT software.
★ 322HTMLupdated 2025-12-15awesomeawesome-listchatgptopenai
Code for the paper "Evaluating Large Language Models Trained on Code"
★ 3,212Pythonupdated 2025-01-17
★ 1Pythonupdated 2024-06-15
DataViz Explorer: React-powered tool for large CSV, database, and real-time visualization. User-friendly interface, interactive plots, Node.js backend for scalability.
★ 41JavaScriptupdated 2024-05-09
Community Earth atmospheric Data System (CEDS)
★ 117Rupdated 2025-06-09dataemissions
Markdown rendering + Latex extras (equations, tables, ...), with conversion features, for the scientific community
★ 664JavaScriptupdated 2026-04-20
Browse a folder containing multiple streamlit apps and launch them immediately
★ 159Pythonupdated 2021-05-28
★ 83Pythonupdated 2025-01-22
A modular voice assistant application for experimenting with state-of-the-art transcription, response generation, and text-to-speech models. Supports OpenAI, Groq, Elevanlabs, CartesiaAI, and Deepgram APIs, plus local models via Ollama. Ideal for research and development in voice technology.
★ 1,119Pythonupdated 2025-11-22
Tock, the open source conversational AI toolkit.
★ 605Kotlinupdated 2026-04-17aialexaapple-business-chatassistantbot
ChatGPT web interface using the OpenAI API
★ 1,984Svelteupdated 2026-04-20
SpeechGPT Series: Speech Large Language Models
★ 1,407Pythonupdated 2024-07-22
A dataset with political datasets
★ 726Rupdated 2026-02-07democracyelectionsinternational-relationsnational-election-studiespolitical-datasets
Powerful AI Client
★ 39,642TypeScriptupdated 2026-04-09assistantchatbotchatgptclaudecopilot
🦙 Local and online AI hub
★ 1,521Pythonupdated 2026-04-08adwaitaflatpakgnomegtk4ollama
Prompt, run, edit, and deploy full-stack web applications using any LLM you want!
★ 19,287TypeScriptupdated 2026-02-07
Prompt, run, edit, and deploy full-stack web applications. -- bolt.new -- Help Center: https://support.bolt.new/ -- Community Support: https://discord.com/invite/stackblitz
★ 16,347TypeScriptupdated 2024-12-17ai-playgroundanthropicchatbotwebcontainers-api
Desktop AI Assistant powered by GPT-5, GPT-4, o1, o3, Gemini, Claude, Ollama, DeepSeek, Perplexity, Grok, Bielik, chat, vision, voice, RAG, image and video generation, agents, tools, MCP, plugins, speech synthesis and recognition, web search, memory, presets, assistants,and more. Linux, Windows, Mac
★ 1,749Pythonupdated 2026-02-06aiai-assistantartificial-intelligenceautonomous-agentchatbot
VoiceGPT is a voice assistant that leverages the powerful ChatGPT chatbot to answer your questions.
★ 340Pythonupdated 2023-09-28
Easily select and manage your preferred AI digital assistants on Android.
★ 1,327Kotlinupdated 2026-03-30aiandroidandroid-applicationassistantchatbot
Browser-Based AI Assistant: Speech-to-Text with Whisper and Local AI Answers
★ 6HTMLupdated 2024-07-04
★ 363TypeScriptupdated 2025-12-01
🤖 Build voice-based LLM agents. Modular + open source.
★ 3,731Pythonupdated 2024-11-15
Chrome extension that allows dictating anywhere using OpenAI Whisper
★ 13JavaScriptupdated 2023-09-29chrome-extensiondictationopenaiopenai-apitext-to-speech
Speech Note Linux app. Note taking, reading and translating with offline Speech to Text, Text to Speech and Machine translation.
★ 1,442C++updated 2026-04-15asrflatpak-applicationslinux-desktopmachine-translationnmt
Instant voice cloning by MIT and MyShell. Audio foundation model.
★ 36,336Pythonupdated 2025-04-19text-to-speechttsvoice-clonezero-shot-tts
a state-of-the-art-level open visual language model | 多模态预训练模型
★ 6,739Pythonupdated 2024-05-29cross-modalitylanguage-modelmulti-modalpretrained-modelsvisual-language-models
Real time transcription with OpenAI Whisper.
★ 2,926Pythonupdated 2025-04-15
Kivywhisper is a cross platform Python GUI for OpenAI's Whisper.
★ 9Pythonupdated 2024-07-26
Modern GUI application that transcribes and translate audio files using OpenAI Whisper.
★ 168Pythonupdated 2024-08-12
A stand-alone application with GUI for OpenAI's Whisper
★ 24Pythonupdated 2024-04-04guihacktoberfestiwr-hacktoberfestopenaipyinstaller
A modern, real-time speech recognition application built with OpenAI's Whisper and PySide6. This application provides a beautiful, native-looking interface for transcribing audio in real-time with support for multiple languages.
★ 200Pythonupdated 2025-09-13
A nearly-live implementation of OpenAI's Whisper.
★ 3,984Pythonupdated 2026-04-16dictationobsopenaiopenvinoopenvino-intel
An AI based news article summariser that summarises, finds the sentiment and author of any online article
★ 33CSSupdated 2024-01-28aiai-summarizernews-summarizernewspaper3kopen-source
Model Context Protocol Servers
★ 84,539TypeScriptupdated 2026-04-17
Create a blog
★ 36Pythonupdated 2024-05-25blogmkdocs-materialtemplate
Extensions for Python Markdown
★ 1,116Pythonupdated 2026-04-20markdownpython
Cloudflare’s documentation
★ 4,657MDXupdated 2026-04-20cloudflaredocshacktoberfestmarkdownmdx
Not just another ChatGPT user-interface!
★ 1,484TypeScriptupdated 2024-06-13chatgptchatgpt-apielectronjavascriptopenai
A simple API that provides information about various Large Language Models (LLMs) and their pricing
★ 25JavaScriptupdated 2024-08-21
Bubblewrap is a Command Line Interface (CLI) that helps developers to create a Project for an Android application that launches an existing Progressive Web App (PWAs) using a Trusted Web Activity.
★ 2,941TypeScriptupdated 2026-04-14
Evals is a framework for evaluating LLMs and LLM systems, and an open-source registry of benchmarks.
★ 18,276Pythonupdated 2026-04-14
BIMP. Batch Image Manipulation Plugin for GIMP.
★ 1,002Cupdated 2024-08-15batch-processingcgimpimage-manipulationplugin
Rigourous evaluation of LLM-synthesized code - NeurIPS 2023 & COLM 2024
★ 1,725Pythonupdated 2025-10-02benchmarkchatgptefficiencygpt-4large-language-models
A VSCode extension for running LLM prompts. It turns VSCode into a powerful prompt IDE.
★ 32TypeScriptupdated 2024-10-11
🐳 Docker Image of NetBox
★ 2,600Pythonupdated 2026-04-14dockerdocker-composedocker-imagehacktoberfestnetbox
Make contextual data visualization with Chat Interface from tabular datasets. AI data visualization.
★ 624TypeScriptupdated 2025-07-03ai-data-visualisationchartchart-gptchartgptchat2vis
Latitude is the open-source agent engineering platform
★ 3,963TypeScriptupdated 2026-04-20
Awesome-LLM: a curated list of Large Language Model
★ 2updated 2023-08-15
MkDocs plugin to generate a RSS feeds for created and updated pages, using git log and YAML frontmatter (page.meta).
★ 131Pythonupdated 2026-04-17mkdocsmkdocs-pluginmkdocs-rss-pluginpypirss-generator
Simplify interactions with Large Language Models
★ 200Pythonupdated 2026-03-17aiai-agentsllmllm-agentllm-framework
A guidance language for controlling large language models.
★ 21,410Jupyter Notebookupdated 2026-04-10
A python program that turns an LLM, running on Ollama, into an automated researcher, which will with a single query determine focus areas to investigate, do websearches and scrape content from various relevant websites and do research for you all on its own! And more, not limited to but including saving the findings for you!
★ 2,966Pythonupdated 2024-12-14
An Open-Source Framework for Prompt-Learning.
★ 4,857Pythonupdated 2024-07-16aideep-learningnatural-language-processingnatural-language-understandingnlp
GitHub Action to Create Pull Request in Parent Repository when Submodules are Updated
★ 57updated 2024-01-31
Build ultra fast, tiny, and cross-platform desktop apps with Typescript.
★ 11,460TypeScriptupdated 2026-04-20
Moved to Codeberg
★ 42,859Zigupdated 2025-11-27compilerlanguagezig
VS Code extension that allows you to edit a Git repo, like it's a multi-file, versioned document.
★ 327TypeScriptupdated 2026-02-12developer-toolsgitproductivityvscodevscode-extension
Framework to bring LLM applications to production
★ 379Pythonupdated 2026-02-05ailangchainllmllmopsml
Debug, evaluate, and monitor your LLM applications, RAG systems, and agentic workflows with comprehensive tracing, automated evaluations, and production-ready dashboards.
★ 19,052Pythonupdated 2026-04-20evaluationhacktoberfesthacktoberfest2025langchainllama-index
🕹️ Open-source, developer-first LLMOps platform designed to streamline prompt design, version management, instant delivery, collaboration, troubleshooting, observability and more.
★ 3,228TypeScriptupdated 2026-03-31aidevtoolsgpt-3gpt-4hacktoberfest
GitHub Books is an open-source book concept to break writing a book into smaller pieces and to make it easier.
★ 7updated 2023-02-13bookgithub-bookstemplate
A MkDocs plugin that lets you exclude/include docs files using globs, regexes, gitignore-style file and Markdown/FrontMatter tags metadata.
★ 10Pythonupdated 2024-10-16excludefrontmattergitignoreglobsinclude
A mkdocs plugin that lets you exclude files or trees from your output.
★ 97Pythonupdated 2023-02-02
A self-hosted, database-less note taking web app that utilises a flat folder of markdown files for storage.
★ 3,002Vueupdated 2026-02-17markdownnotenote-takingnotesnotes-app
Let your Claude able to think
★ 17,004TypeScriptupdated 2026-04-07
The comfortable Git UI for Linux
★ 326Pythonupdated 2026-04-11
OWASP Top 10 for Large Language Model Apps (Part of the GenAI Security Project)
★ 1,213Pythonupdated 2026-02-22aiappsecllmllm-security
MkDocs plugin for Ultralytics Docs at https://docs.ultralytics.com
★ 70Pythonupdated 2026-04-18documentationmkdocspythonultralyticsyolo
Mkdocs plugin for generating navigation by directory structure
★ 6Pythonupdated 2024-09-30
✚ Build multiple documentation folders in a single Mkdocs. Designed for large codebases.
★ 393Pythonupdated 2025-06-15documentationmkdocsmkdocs-monorepo-pluginmonolithsmonorepos
Merge the source of multiple MkDocs sites into a single one
★ 23Pythonupdated 2025-07-05mkdocsmkdocs-sites
Documentation that simply works
★ 26,622Pythonupdated 2026-04-16documentationframeworkmaterial-designmkdocsplugins
🔮 This plugin adds JS to open outgoing links and PDFs in a new tab.
★ 45Pythonupdated 2024-11-18jsmarkdownmkdocsnew-tabnew-tab-page
22 prompt engineering techniques with hands-on Jupyter Notebook tutorials, from fundamental concepts to advanced strategies for leveraging LLMs.
★ 7,438Jupyter Notebookupdated 2026-04-15aichatgptclaudegenailangchain
Project documentation with Markdown.
★ 22,017Pythonupdated 2025-10-20documentationmarkdownmkdocspythonstatic-site-generator
:trophy: :books: A list of awesome MkDocs projects and plugins.
★ 1,731Pythonupdated 2026-04-16best-ofbest-of-listmkdocs
MkDocs plugin to programmatically generate documentation pages during the build
★ 140Pythonupdated 2026-04-17mkdocsmkdocs-pluginmkdocstrings
A plugin for customizing the navigation structure of your MkDocs site.
★ 623Pythonupdated 2026-04-10markdownmkdocspythonwiki
GitHub Action to deploy an MkDocs site to GitHub Pages
★ 276Shellupdated 2024-07-19
Lord of Large Language and Multi modal Systems Web User Interface
★ 4,781Pythonupdated 2026-04-16aillmtext-generation
🎮 ⌨ An easy to use tool to change the behaviour of your input devices.
★ 5,577Pythonupdated 2026-04-19gamepadgamingkeyboardkeyboard-shortcutslinux
[ICLR 2025] LongWriter: Unleashing 10,000+ Word Generation from Long Context LLMs
★ 1,857Pythonupdated 2025-06-24fine-tuningllmlong-contextlong-text
The official repo of Qwen (通义千问) chat & pretrained large language model proposed by Alibaba Cloud.
★ 21,071Pythonupdated 2026-03-05chineseflash-attentionlarge-language-modelsllmnatural-language-processing
A fast multimodal LLM for real-time voice
★ 4,403Pythonupdated 2025-12-12aillmslmspeech
The LLM Evaluation Framework
★ 14,989Pythonupdated 2026-04-20evaluation-frameworkevaluation-metricsllm-evaluationllm-evaluation-frameworkllm-evaluation-metrics
Open source platform for AI Engineering: OpenTelemetry-native LLM Observability, GPU Monitoring, Guardrails, Evaluations, Prompt Management, Vault, Playground. 🚀💻 Integrates with 50+ LLM Providers, VectorDBs, Agent Frameworks and GPUs.
★ 2,400TypeScriptupdated 2026-04-20ai-observabilityamd-gpuclickhousedistributed-tracinggenai
Automatic Generation of Visualizations and Infographics using Large Language Models
★ 3,248Jupyter Notebookupdated 2024-08-08coheredatavisualizationhacktoberfestllmopenai
An advanced keyboard manager
★ 4,963Haskellupdated 2026-04-17cross-platformhaskellkeyboardkeyboard-layoutlinux
State-of-the-art offline (or networked) voice typing everywhere + text terminals (Linux or WFL session on Windows.) with a simple bash script. Usable with X. Does not require X.
★ 154Shellupdated 2026-03-03bashcommand-linefreelightweightopen-source
Simple frontend for LLMs built in react-native.
★ 2,347TypeScriptupdated 2026-04-15
The reactive dataflow runtime that powers Observable Framework and Observable notebooks
★ 1,071JavaScriptupdated 2024-11-06
Bookworm Light is a feature-rich, minimal, highly customizable, easy-to-use Astro blog theme.
★ 370Astroupdated 2026-04-12astro-buildastro-templateastro-themeastro-themesblog
Simple, hackable offline speech to text - using the VOSK-API.
★ 1,818Pythonupdated 2025-10-10
Material Design icons by Google (Material Symbols)
★ 53,186updated 2026-04-17androidiconsiosmaterialmaterial-design
Font files available from Google Fonts, and a public issue tracker for all things Google Fonts
★ 19,980HTMLupdated 2026-04-17
Pointers to all templates and implementations based on static site generators
★ 71updated 2019-02-05docpaddocumentationgatsbyhexohugo
A fast, clean, responsive Hugo theme.
★ 13,411HTMLupdated 2026-04-11blogblog-themecleanfastfeature-rich
🐻 Personal curriculum vitae or resume theme for Hugo
★ 38CSSupdated 2023-05-24hugohugo-theme
Developer blog website built with Astro and Tailwind.
★ 68MDXupdated 2026-04-08astroblogportfolioreactstatic-site
Awesome Restic related projects
★ 734updated 2026-03-02backupsrestic
🃏 A magical documentation site generator.
★ 31,170JavaScriptupdated 2026-04-15docdocsdocsifydocumentationdocumentation-tool
Data import tools for OSI
★ 1TypeScriptupdated 2024-06-07
📝 Minimalistic Vue-powered static site generator
★ 22,793JavaScriptupdated 2024-08-07blog-enginedocs-generatorseostatic-site-generatorvue
A modern, high customizable, responsive Jekyll theme for documentation with built-in search.
★ 8,971SCSSupdated 2026-04-17documentationgithub-pagesjekylljekyll-theme
🐣 Minimal template for using Hextra for Hugo
★ 183updated 2026-03-06hextrahugostatic-sitetemplate
🔯 Modern, batteries-included Hugo theme for creating beautiful doc, blog and static websites
★ 2,127HTMLupdated 2026-04-17cleandocumentationdocumentation-sitegithub-pagesgolang
Hugo theme for open source documentation
★ 2,931JavaScriptupdated 2026-04-08docsydocumentation-sitedocumentation-websitehugohugo-theme
★ 12,208Pythonupdated 2026-02-01
📦 Repomix is a powerful tool that packs your entire repository into a single, AI-friendly file. Perfect for when you need to feed your codebase to Large Language Models (LLMs) or other AI tools like Claude, ChatGPT, DeepSeek, Perplexity, Gemini, Gemma, Llama, Grok, and more.
★ 23,881TypeScriptupdated 2026-04-20aianthropicartificial-intelligencechatbotchatgpt
🌸 Run LLMs at home, BitTorrent-style. Fine-tuning and inference up to 10x faster than offloading
★ 10,090Pythonupdated 2024-09-07bloomchatbotdeep-learningdistributed-systemsfalcon
Composio powers 1000+ toolkits, tool search, context management, authentication, and a sandboxed workbench to help you build AI agents that turn intent into action.
★ 27,915TypeScriptupdated 2026-04-20agentic-aiagentsaiai-agentsaiagents
This is a repo with links to everything you'd ever want to learn about data engineering
★ 41,090Jupyter Notebookupdated 2026-04-02apachesparkawesomebigdatadatadataengineering
Deprecated inference engine
★ 1,229Pythonupdated 2025-09-06
Chat with your documents on your local device using GPT models. No data leaves your device and 100% private.
★ 22,206Pythonupdated 2026-03-10
YaST module autoinstallation
★ 26Rubyupdated 2026-03-25
Core OSSIM (Open Source Software Image Map) package including C++ code for OSSIM library, command-line applications, tests, and build system
★ 325C++updated 2026-04-17geointimage-processingimageryorthorectifysatellite
Desktop application for Linux and Windows that utilizes distil-whisper models from HuggingFace, to enable real-time offline speech-to-text dictation.
★ 60Pythonupdated 2025-10-16desktop-appdictationdistil-whisperhuggingfaceoffline
The all-in-one AI productivity accelerator. On device and privacy first with no annoying setup or configuration.
★ 58,999JavaScriptupdated 2026-04-17ai-agentscustom-ai-agentsdeepseekkimillama3
The Wysiwyg Editor for Markdown: 100% CommonMark + GFM with Uploads and Image Resizing
★ 365TypeScriptupdated 2024-09-29
Enhanced ChatGPT Clone: Features Agents, MCP, DeepSeek, Anthropic, AWS, OpenAI, Responses API, Azure, Groq, o1, GPT-5, Mistral, OpenRouter, Vertex AI, Gemini, Artifacts, AI model switching, message search, Code Interpreter, langchain, DALL-E-3, OpenAPI Actions, Functions, Secure Multi-User Auth, Presets, open-source for self-hosting. Active.
★ 36,001TypeScriptupdated 2026-04-20aianthropicartifactsawsazure
AI chat for any model.
★ 33,185TypeScriptupdated 2024-08-03
An open source, privacy focused alternative to NotebookLM for teams with no data limits. Join our Discord: https://discord.gg/ejRNvftDp9
★ 13,996Pythonupdated 2026-04-18agentagentsaichrome-extensionextension
Open-ended wargames with large language models
★ 52Pythonupdated 2026-02-11human-ai-teaminglarge-language-modelsmulti-agent-systemstabletop-exerciseswargames
Distribute and run LLMs with a single file.
★ 24,274C++updated 2026-04-17cross-platformggufllama-cpplocal-ailocal-inference
Cross-platform desktop GUI app to clean image metadata
★ 2,419Perlupdated 2026-04-03concurrencydark-modedesktop-appelectronexif
Open source web application for the storage of dynamic CSV files, user management, email notifications and more ...
★ 53Vueupdated 2025-03-08csvemail-notificationshacktoberfestjavascriptopen-source
Backend and API routes for Open Sustainability Index
★ 9PLpgSQLupdated 2024-11-18remixsupabaseswaggertypescriptvite
Docs for the entire Open Sustainability Index
★ 1updated 2024-10-28code-of-conductcontributinglicense
A playground for data innovation. Imagine a world in which sustainability data is publicly shared, what information would you contribute, and for what purpose??
★ 1Javaupdated 2024-07-27
User-friendly AI Interface (Supports Ollama, OpenAI API, ...)
★ 134,144Pythonupdated 2026-04-20aillmllm-uillm-webuillms
MongoDB Knowledge Service. Powered by MongoDB and Atlas Vector Search.
★ 196TypeScriptupdated 2025-09-29chatbotmongodbmongodb-atlasragretrieval-augmented-generation
AlwaysReddy is a LLM voice assistant that is always just a hotkey away.
★ 763Pythonupdated 2025-03-04
Archivy is a self-hostable knowledge repository that allows you to learn and retain information in your own personal and extensible wiki.
★ 3,256Pythonupdated 2023-07-25clidigital-brainelasticsearchhacktoberfestknowledge
Graphical user interface for managing your Linux applications. Supports AppImage, Debian and Arch packages (including AUR), Flatpak, Snap and native Web applications
★ 1,362Pythonupdated 2024-10-13appimagearcharchlinuxaurdebian
💐 Publish markdown (and html) websites, docs, wikis and websites in seconds. Integrates with your AI.
★ 1,072TypeScriptupdated 2026-04-20bloggingcmsdigital-gardenmarkdownmdx
Find, verify, and analyze leaked credentials
★ 25,915Goupdated 2026-04-20credentialsdevsecopsdynamic-analysisprecommitscanning
🌱 a fast, batteries-included static-site generator that transforms Markdown content into fully functional websites
★ 11,972TypeScriptupdated 2026-04-20digital-gardennetworked-thoughtobsidianobsidian-mdquartz-ssg
Process Obsidian notes to publish them with Hugo. Supports transformation of Obsidian wiki links into Hugo shortcodes for internal linking.
★ 421Pythonupdated 2023-03-21bloggingclihugohugo-helperobsidian
A minimal & fast Hugo theme for bloggers
★ 1,152HTMLupdated 2023-06-27blog-themehugo-theme
A theme for Hugo based on VMware Clarity
★ 642HTMLupdated 2026-03-07blogblog-themehugohugo-themepersonal-site
A curated list of resources for graph databases and graph computing tools
★ 1,252updated 2026-02-26graphgraph-computinggraph-databasegraphdbolap
Graphs for Everyone
★ 16,371Javaupdated 2026-04-01cypherdatabasegraphgraph-databasegraphdb
Gatsby starter for creating a blog
★ 3,517JavaScriptupdated 2026-04-15
Modern Confluence alternative designed for internal & external docs, built with Go + EmberJS
★ 2,384JavaScriptupdated 2025-09-19collaborationconfluencedashboardsdocsdocument-conversion
A complete web-based remote monitoring and management web site. Once setup you can install agents and perform remote desktop session to devices on the local network or over the Internet.
★ 6,450HTMLupdated 2026-04-20amtfile-transferintel-amtkvmremote-control
fork of sysmteback, a useful system backup tool
★ 210C++updated 2024-11-14
Voilà turns Jupyter notebooks into standalone web applications
★ 5,919Pythonupdated 2026-04-06dashboardingjupyterjupyter-notebookjupyterlab-extension
Turn Tweet IDs into Twitter JSON & CSV from your desktop!
★ 438JavaScriptupdated 2023-04-18
Web Extension for saving a faithful copy of a complete web page in a single HTML file
★ 20,985JavaScriptupdated 2026-02-24annotationsarchivearchiverauto-savebrowser
An advanced Twitter scraping & OSINT tool written in Python that doesn't use Twitter's API, allowing you to scrape a user's followers, following, Tweets and more while evading most API limitations.
★ 16,367Pythonupdated 2023-02-23elasticsearchkibanaosintpythonscrape
Browsertrix is the hosted, high-fidelity, browser-based crawling service from Webrecorder designed to make web archiving easier and more accessible for all!
★ 404TypeScriptupdated 2026-04-17archivingcloudkuberneteswaczwarc
Command line Kiwix tools: kiwix-serve, kiwix-manage, ...
★ 852C++updated 2026-03-02daemonhttpkiwixlibraryoffline
Tool for creating snapshots and remote backups of btrfs subvolumes
★ 2,069Perlupdated 2025-11-29backupbtrfsencrypted-backupsincremental-backupssnapshot
GUI for snapper, a tool for Linux filesystem snapshot management, works with btrfs, ext4 and thin-provisioned LVM volumes
★ 260Pythonupdated 2023-12-23btrfsfilesystemguilinuxsnapper
A Dall-E 3 localhost web UI for using advanced settings like style (vivid vs natural) or quality (standard vs hd). Can also be used when ChatGPT's Dall-E throttles you for the day, if you are ready to pay the API call costs. Comes integrated with Prompt Inspirer!
★ 105JavaScriptupdated 2025-05-10
Invoke is a leading creative engine for Stable Diffusion models, empowering professionals, artists, and enthusiasts to generate and create visual media using the latest AI-driven technologies. The solution offers an industry leading WebUI, and serves as the foundation for multiple commercial products.
★ 27,049TypeScriptupdated 2026-04-20ai-artartificial-intelligencegenerative-artimage-generationimg2img
Relax-and-Recover - Linux bare metal disaster recovery and system migration solution (cfr. mksysb, ignite)
★ 1,090Shellupdated 2026-04-13
Country polygons as GeoJSON in a datapackage
★ 573Makefileupdated 2025-04-10
List of popular and awesome open standards
★ 21updated 2025-02-25openstandards
A collection of interesting Trilium Notes extensions. Including themes, widgets, scripts, API extensions, etc. Trilium插件合集
★ 856updated 2026-04-19apiawesomeawesome-listetapiextension
waifu2x converter ncnn version, runs fast on intel / amd / nvidia / apple-silicon GPU with vulkan
★ 3,382C++updated 2026-04-13amdgpuintellinuxmacos
🆙 Upscayl - #1 Free and Open Source AI Image Upscaler for Linux, MacOS and Windows.
★ 44,856TypeScriptupdated 2026-03-27aielectronesrgangigapixelgigapixel-images
Download fonts from the web!
★ 176Pythonupdated 2025-09-18download-fontsgoogle-fontsgtklanguagelibhandy
Download Google webfonts on the Linux desktop
★ 90Pythonupdated 2021-08-13fontslinux-desktoppythonweb-fonts
Simple shell script to use OpenAI's ChatGPT and DALL-E from the terminal. No Python or JS required. Formerly https://gptshell.cc
★ 1,238Shellupdated 2024-06-19bashchatbotchatgptchatgpt-apichatgpt-api-wrapper
A command-line productivity tool powered by AI large language models like GPT-5, will help you accomplish your tasks faster and more efficiently.
★ 12,013Pythonupdated 2026-04-11chatgptcheat-sheetclicommandsgpt-3
A fast and flexible keyboard launcher
★ 7,904C++updated 2026-04-02albertalbertlauncherapplication-launchercppkeyboard-launcher
Kepler.gl is a powerful open source geospatial analysis tool for large-scale data sets.
★ 11,778TypeScriptupdated 2026-04-20data-visualizationgeospatialkeplermapboxvisualization
A search engine that "just works" for Obsidian. Supports OCR and PDF indexing.
★ 1,943TypeScriptupdated 2026-02-28minisearchobsidianobsidian-mdobsidian-pluginocr
United Nations General Assembly Voting Data
★ 69Rupdated 2021-03-09
Simple yet effective command line client for chatting with ChatGPT using the official API
★ 479Pythonupdated 2025-11-02apichatgptchatgpt-apicliopenai
ChatGPT CLI is a powerful, multi-provider command-line interface for working with modern LLMs. It supports OpenAI, Azure, Perplexity, LLaMA, and more, with features like streaming, interactive chat, prompt files, image/audio I/O, MCP tool calls, and an experimental agent mode for safe, multi-step automation.
★ 917Goupdated 2026-03-22agentagentic-aiazurechatgptcli
Yet Another Dotfiles Manager
★ 6,258Pythonupdated 2026-04-13bashbootstrapcommandlinedot-filesdotfile-management
LMDeploy is a toolkit for compressing, deploying, and serving LLMs.
★ 7,817Pythonupdated 2026-04-20codellamacuda-kernelsdeepspeedfastertransformerinternlm
The world's most popular open source digital signage project.
★ 3,495Pythonupdated 2026-04-17digital-signageiotpythonraspberry-pi
A simple, fully responsive Dashboard to forward to the services of your choice!
★ 315HTMLupdated 2022-03-30dashboarddashboardsdesktopfont-awesomehomepage
Another web application bookmark dashboard, with fun features.
★ 1,264Pythonupdated 2022-03-30
RAGFlow is a leading open-source Retrieval-Augmented Generation (RAG) engine that fuses cutting-edge RAG with Agent capabilities to create a superior context layer for LLMs
★ 79,009Pythonupdated 2026-04-20llm-app
A free, self-hostable news aggregator…
★ 14,858PHPupdated 2026-04-19feedfreshrssnews-aggregatorphprss
List of dashboards free to use
★ 431updated 2024-01-15hacktoberfest
A curated list of amazingly awesome dashboards/visualization resources.
★ 1,133updated 2026-03-16awesomeawesome-listdashboard
Precis is an extensible self-hosted AI-enabled RSS reader with a focus on notifications and support for theming
★ 93Pythonupdated 2024-12-15aidaisyuidockerdocker-composefastapi
NewsBlur is a personal news reader that brings people together to talk about the world. A new sound of an old instrument.
★ 7,437Pythonupdated 2026-04-17androidelasticsearchfeed-readeriosmongodb
A news dashboard inspired by iGoogle and Netvibes
★ 65TypeScriptupdated 2026-03-07aggregatordashboardfeed-readerfeedreaderhomepage
A self-hosted dashboard that puts all your feeds in one place
★ 33,753Goupdated 2025-12-10aggregatordashboarddockerfeed-readergo
multipurpose rss reader, live stream, mashup, aggregation web application
★ 2,458HTMLupdated 2026-04-02aggregatorhacktoberfestmashupnews-feedphp
A scheduler for GPU/CPU tasks
★ 408Cupdated 2024-03-06ccppdebiangpu-supportjob-scheduler
Split Browser - a minimalistic, ultra-lightweight, open source web browser based on WebKit/Ultralight/native webview with a split screen (tiled) view
★ 133Cupdated 2026-02-11browserqtsplit-screenwebwebkit
🧡 Everything is RSSible
★ 43,639TypeScriptupdated 2026-04-20bilibilidoubandribbbleinstagramlofter
GUI Wrapper for Pandoc (Crossplatform)
★ 43Pythonupdated 2023-12-29
FinGPT: Open-Source Financial Large Language Models! Revolutionize 🔥 We release the trained model on HuggingFace.
★ 19,816Jupyter Notebookupdated 2026-04-19chatgptfinancefingptfintechlarge-language-models
🚀 Less chaos. More flow.
★ 8,880TypeScriptupdated 2026-02-04aiapplicationbrowserchatgptclaude
🔮 ChatGPT Desktop Application (Mac, Windows and Linux)
★ 54,372Rustupdated 2024-08-29aiappapplicationchatgptdesktop-app
Clipboard manager with advanced features
★ 11,627C++updated 2026-04-16clipboardclipboard-managercopyqcross-platformscripting
Converts your favorite web apps into desktop apps with their own dedicated launcher icon.
★ 495CSSupdated 2026-04-17
An awesome list of best top AI directories to submit your ai tools
★ 787updated 2026-02-14ai-directoriesai-directoryai-directory-listai-listai-pedia-hub
Large language models (LLMs) made easy, EasyLM is a one stop solution for pre-training, finetuning, evaluating and serving LLMs in JAX/Flax.
★ 2,520Pythonupdated 2024-08-13chatbotdeep-learningflaxjaxlanguage-model
Repository to track the progress in Natural Language Processing (NLP), including the datasets and the current state-of-the-art for the most common NLP tasks.
★ 22,972Pythonupdated 2024-07-28dialoguemachine-learningmachine-translationnamed-entity-recognitionnatural-language-processing
★ 1,646Pythonupdated 2023-04-27
AMD ROCm™ Software - GitHub Home
★ 6,421Shellupdated 2026-04-17documentation
TorchBench is a collection of open source benchmarks used to evaluate PyTorch performance.
★ 1,030Pythonupdated 2026-04-17benchmarkpytorch
An elegant Linux app for the Elgato Stream Deck with support for plugins
★ 1,014Pythonupdated 2026-04-13gtkgtk4streamcontroller
The exceptionally handsome dashboard framework in Ruby and Coffeescript.
★ 3,296JavaScriptupdated 2023-03-10dashboarddashboard-applicationdashboard-widgetdashboard-widgetsdashboards
Run any open-source LLMs, such as DeepSeek and Llama, as OpenAI compatible API endpoint in the cloud.
★ 12,298Pythonupdated 2026-04-13bentomlfine-tuningllamallama2llama3-1
Data context layer for unstructured data - images, video, sensor data, text and PDFs
★ 2,737Pythonupdated 2026-04-20claude-codecodexdata-context-layerdata-processingharness
Open source UI framework written in Python, running on Windows, Linux, macOS, Android and iOS
★ 18,917Pythonupdated 2026-04-16androidappioskivylinux
Python client for Replicate
★ 902Pythonupdated 2025-08-26
AgentCoder: multi-agent code generation framework.
★ 384Pythonupdated 2025-11-18multi-agent-code-generation
Run agents that work for you based on what you do. AI finally knows what you are doing
★ 18,404Rustupdated 2026-04-20agentsagiaicomputer-visionllm
o1-engineer is a command-line tool designed to assist developers in managing and interacting with their projects efficiently. Leveraging the power of OpenAI's API, this tool provides functionalities such as code generation, file editing, and project planning to streamline your development workflow.
★ 2,854Pythonupdated 2024-12-16
Home of StarCoder: fine-tuning & inference!
★ 7,515Pythonupdated 2024-02-27
Israeli Pikud Haoref missile detection API
★ 69Pythonupdated 2023-05-11alertsgazagazastripilirondome
🚀🤖 Crawl4AI: Open-source LLM Friendly Web Crawler & Scraper. Don't be shy, join here: https://discord.gg/jP8KfhDhyN
★ 64,592Pythonupdated 2026-04-20
Project Manager Extension for Visual Studio Code
★ 2,412TypeScriptupdated 2026-04-08project-managementtypescriptvisual-studio-codevscodevscode-extension
GitKraken CLI Releases and Documentation
★ 399updated 2026-04-17cligitgitkrakenterminal
Toolkit for creating, sharing and using natural language prompts.
★ 3,008Pythonupdated 2023-10-23machine-learningnatural-language-processingnlp
GPT4All: Run Local LLMs on Any Device. Open-source and available for commercial use.
★ 77,372C++updated 2025-05-27ai-chatllm-inference
★ 18updated 2022-08-16
An awesome & curated list to plugins and themes to Obsidian.md
★ 86updated 2021-10-04
🕶️ Awesome stuff for Obsidian
★ 8,709CSSupdated 2024-04-06awesomeawesome-listobsidian
Chat with your notes & see links to related content with AI embeddings. Use local models or 100+ via APIs like Claude, Gemini, ChatGPT & Llama 3
★ 4,901JavaScriptupdated 2026-04-18chatgptclaudeembeddingsgeminillama3
Prompt Engineering Research Tool for AI APIs
★ 129TypeScriptupdated 2026-04-09ai-researchgpt-3obsidian-mdobsidian-pluginopenai
An unobtrusive Obsidian plugin that quietly processes equations and patterns in real time
★ 123TypeScriptupdated 2025-04-20datetimeequations-solvergrammarmathematicsnatural-language-processing
Auto classification plugin for Obsidian using ChatGPT.
★ 130TypeScriptupdated 2025-09-09
★ 48TypeScriptupdated 2024-04-15
A plugin for Obsidian that allows you to create a canvas conversation using ChatGPT.
★ 104TypeScriptupdated 2023-03-18
Autocomplete your obsidian notes with AI, including ChatGPT, through a copilot-like interface.
★ 355TypeScriptupdated 2024-05-28aiai21labschatgptgroqgroq-ai
★ 158TypeScriptupdated 2026-04-20
Text Generator is a versatile plugin for Obsidian that allows you to generate text content using various AI providers, including OpenAI, Anthropic, Google and local models.
★ 1,918TypeScriptupdated 2026-04-08aichatgptgpt-3gpt-4huggingface
A ChatGPT bot trained on your vault notes. Ask your AI questions about your own thoughts and ideas!
★ 124TypeScriptupdated 2023-06-03
★ 13TypeScriptupdated 2023-06-20
Obsidian canvas plugin for using AI completion with threads of canvas nodes
★ 141TypeScriptupdated 2024-07-31gptobsidian
★ 22JavaScriptupdated 2023-06-28
★ 15TypeScriptupdated 2024-03-09
★ 20TypeScriptupdated 2023-12-28
THE Copilot in Obsidian
★ 6,787TypeScriptupdated 2026-04-20aiaiagentchatgptcopilotobsidian-plugin
Turbocharge Your Note-taking with AI Assistance
★ 22JavaScriptupdated 2024-12-05
Local Ollama and OpenAI-like GPT's assistance for maximum privacy and offline access
★ 639TypeScriptupdated 2026-04-18
★ 10TypeScriptupdated 2023-08-30
A (nearly) seamless integration of ChatGPT into Obsidian.
★ 1,390TypeScriptupdated 2026-02-11
💬 Experience OpenAI ChatGPT assistance directly within Obsidian, drafting content without interrupting your creative flow.
★ 25JavaScriptupdated 2025-02-11chatgpt-apigptobsidianobsidian-mdobsidian-plugin
Ask GPT from your notes and get personalized answers based on your knowledge base.
★ 49TypeScriptupdated 2023-05-21obsidian-mdobsidian-plugintypescript
An Obsidian plugin to generate notes based on GP3 output.
★ 171TypeScriptupdated 2023-11-10
Generate interactive flashcards from your notes using models from OpenAI (ChatGPT), Google (Gemini), Ollama (local LLMs), and more. Or manually create your own to use with the quiz UI.
★ 175TypeScriptupdated 2024-11-13chatgptclaudecohereeducationflashcards
Generate and brainstorm ideas while creating your notes using Large Language Models (LLMs) from Ollama, LM Studio, Anthropic, Google Gemini, Mistral AI, OpenAI, and more for Obsidian.
★ 525TypeScriptupdated 2024-09-12anthropic-claudemistralaiobsidian-pluginollamaopenai-api
InsightA is an Obsidian plugin, can transform long articles into concise, atomic notes, and create well-organized Map of Content (MOC) for notes using LLM. This tool is ideal for anyone aiming to distill complex information into structured, interconnected notes, drawing inspiration from the Zettelkasten method.
★ 22TypeScriptupdated 2024-11-06aillmobsidianobsidian-plugin
An Obsidian plugin that generates latex code from natural language inputs.
★ 9TypeScriptupdated 2024-09-14
Simple Prompt Plugin is a plugin for Obsidian that allows you generate content in your notes using LLMs.
★ 14TypeScriptupdated 2024-06-16aillmnodeobsidianobsidian-md
This is my first go at making an Obsidian plugin to elaborate on and describe selected bits of information and their context.
★ 5TypeScriptupdated 2024-06-19
Cloud Atlas Obsidian Client
★ 28TypeScriptupdated 2025-06-02
★ 43TypeScriptupdated 2025-01-06
Caret, an Obsidian Plugin
★ 201TypeScriptupdated 2026-04-16
Cannoli allows you to build and run no-code LLM scripts using the Obsidian Canvas editor.
★ 405TypeScriptupdated 2025-11-13
Zettelkasten note taking powered by Large Language Models
★ 62TypeScriptupdated 2025-11-28
Use Large Language Models (such as ChatGPT) to automatically generate flashcards from obsidian notes
★ 50JavaScriptupdated 2025-07-07
Let the OpenAI LLM add nodes to your Obsidian canvas
★ 38TypeScriptupdated 2026-01-17
An Obsidian plugin to process text, chat with AI, and semantically search your notes — works with any OpenAI-compatible LLM server (Ollama, LM Studio, vLLM, and more).
★ 59TypeScriptupdated 2026-04-18
Lets to use local llms in your Obsidian Vaults, extend your stories or create entirely new texts based on your previous input
★ 65TypeScriptupdated 2024-06-30aillmlocalobsidianollama
EasyAdmin is a fast, beautiful and modern admin generator for Symfony applications.
★ 4,276PHPupdated 2026-04-19adminbackendbundlegeneratorhacktoberfest
LaraAdmin is a Open source Laravel Admin Panel / CMS which can be used as Admin Backend, Data Management Tool or CRM boilerplate for Laravel with features like Advanced CRUD Generation, Module Manager, Backups and many more.
★ 1,583JavaScriptupdated 2024-01-05
A feathers rest client for react-admin
★ 160JavaScriptupdated 2026-01-21admin-dashboardfeathersfeathers-clientfeathersjsreact
Meteor, the JavaScript App Platform
★ 44,767JavaScriptupdated 2026-04-20build-systemframeworkhacktoberfestjavascriptmeteor
:tada: A magical vue admin https://panjiachen.github.io/vue-element-admin
★ 90,285Vueupdated 2024-10-24adminadmin-dashboardadmin-templateaxiosdashboard
★ 1TypeScriptupdated 2019-11-14
MERN Antd Admin MongoDB Nodejs React Node Js Rest Api CRUD Auth
★ 663JavaScriptupdated 2025-07-31antd-adminantd-admin-reactantd-starter-kitmern-boilerplatemern-dashboard
✨ The Next Gen Airtable Alternative: No-Code Postgres
★ 21,176TypeScriptupdated 2026-04-20airtableairtable-alternativeapp-builderdatabaseinternal-tool
KDE Plasma widget to adjust the brightness of multiple external monitors
★ 411Pythonupdated 2024-10-10
Letta is the platform for building stateful agents: AI with advanced memory that can learn and self-improve over time.
★ 22,293Pythonupdated 2026-04-12aiai-agentsllmllm-agent
Test your prompts, agents, and RAGs. Red teaming/pentesting/vulnerability scanning for AI. Compare performance of GPT, Claude, Gemini, Llama, and more. Simple declarative configs with command line and CI/CD integration. Used by OpenAI and Anthropic.
★ 20,570TypeScriptupdated 2026-04-20cici-cdcicdevaluationevaluation-framework
Inference code for CodeLlama models
★ 16,335Pythonupdated 2024-08-12
The agent engineering platform
★ 134,936Pythonupdated 2026-04-19agentsaiai-agentsanthropicchatgpt
Open-source AI orchestration framework for building context-engineered, production-ready LLM applications. Design modular pipelines and agent workflows with explicit control over retrieval, routing, memory, and generation. Built for scalable agents, RAG, multimodal applications, semantic search, and conversational systems.
★ 24,992MDXupdated 2026-04-20agentagentsaigeminigenerative-ai
The Axelor Open Suite based on Axelor Open Platform
★ 947Javaupdated 2026-04-20
Free and Open Source Enterprise Resource Planning (ERP)
★ 33,208Pythonupdated 2026-04-20accountingasset-managementcrmdistributionerp
Bring projects, wikis, and teams together with AI. AppFlowy is the AI collaborative workspace where you achieve more without losing control of your data. The leading open source Notion alternative.
★ 70,019Dartupdated 2026-04-08blogconfluence-alternativecontent-managementcontent-servicesdocumentation
Boost Note is a document driven project management tool that maximizes remote DevOps team velocity.
★ 4,049TypeScriptupdated 2026-03-17agile-developmentboostnotedeveloper-toolsdevopsdocumentation-tool
Mattermost is an open source platform for secure collaboration across the entire software development lifecycle..
★ 36,371TypeScriptupdated 2026-04-20collaborationgolanghacktoberfestmattermostmonorepo
SikuliX version 2.0.0+ (2019+)
★ 3,166Javaupdated 2026-04-08javajava-aware-languageslinuxmacosmacosm1
★ 1JavaScriptupdated 2018-03-19
Laravel Migrations Generator: Automatically generate your migrations from an existing database schema.
★ 3,332PHPupdated 2023-02-17existing-databaselaravel-migrationphp
Laravel Migrations Generator: Automatically generate your migrations from an existing database schema.
★ 2,853PHPupdated 2026-03-15database-migrationsexisting-databaselaravellumenmigrations
Create Admin Panels faster on Node.js and Vue.js with AdminForth Framework. Setup main CRUD pages within minutes, extend as you need with Vue3
★ 292TypeScriptupdated 2026-04-20admin-dashboardadmin-live-paneladmin-paneladmin-templateadmin-ui
Amplication brings order to the chaos of large-scale software development by creating Golden Paths for developers - streamlined workflows that drive consistency, enable high-quality code practices, simplify onboarding, and accelerate standardized delivery across teams.
★ 15,992TypeScriptupdated 2026-04-17apicode-generationcsharpcsharp-codedotnet
RailsAdmin is a Rails engine that provides an easy-to-use interface for managing your data
★ 7,954Rubyupdated 2025-09-14
A Rails engine that helps you put together a super-flexible admin dashboard.
★ 6,020JavaScriptupdated 2026-04-08admin-dashboardrailsruby
Apache Airflow - A platform to programmatically author, schedule, and monitor workflows
★ 45,200Pythonupdated 2026-04-20airflowapacheapache-airflowautomationdag
Milvus is a high-performance, cloud-native vector database built for scalable vector ANN search
★ 43,986Goupdated 2026-04-20annscloud-nativediskanndistributedembedding-database
NocoBase is the most extensible AI-powered no-code/low-code platform for building business applications and enterprise solutions.
★ 22,207TypeScriptupdated 2026-04-20admin-dashboardairtableapp-buildercrmcrud
"The mother of all demo apps" — Exemplary fullstack Medium.com clone powered by React, Angular, Node, Django, and many more
★ 83,275TypeScriptupdated 2026-04-14
Supabase CLI. Manage postgres migrations, run Supabase locally, deploy edge functions. Postgres backups. Generating types from your database schema.
★ 2,170Goupdated 2026-04-19clidatabasedatabase-managementdbmsenvironment
Free and open-source admin dashboard template built with Flowbite, Svelte, and Tailwind CSS
★ 499CSSupdated 2025-11-18
AdminJS is an admin panel for apps written in node.js
★ 8,929TypeScriptupdated 2025-07-15adminadmin-dashboardadmin-panelmongodbnodejs
Curated List of Awesome Django Admin Panel Articles, Libraries/Packages, Books, Themes, Videos, Resources.
★ 1,236updated 2026-02-24articleawesomeawesome-listdjangodjango-admin
Django Dashboards - Admin Panels coded in Django | App-Generator.dev
★ 429updated 2025-11-16django-applicationdjango-dashboardsdjango-free-startersdjango-projectdjango-resources
QuickAdd for Obsidian
★ 2,179TypeScriptupdated 2026-04-11obsidianobsidian-mdobsidian-plugin
A template plugin for obsidian
★ 4,848TypeScriptupdated 2026-04-19obsidian-mdobsidian-plugin
An open source personal productivity platform built on Markdown, turbo charged with the scripting power of Lua
★ 5,130TypeScriptupdated 2026-04-20end-user-programmingknowledge-managementluamarkdownnote-taking
📒 Self hosted note taking app stored on S3
★ 2,147TypeScriptupdated 2025-11-15dockermarkdownminionote-takings3
A GraphQL data provider for react-admin and supabase (pg_graphql) built with Apollo.
★ 3TypeScriptupdated 2024-09-17
Wiki.js | A modern and powerful wiki app built on Node.js
★ 28,233Vueupdated 2026-04-20cross-platformdocumentationgitmarkdownnodejs
Docker environment for developing, deploying, and running Frappe applications (ERPNext and custom apps) in production and development
★ 2,326Pythonupdated 2026-04-20appsbusiness-softwarecontainerscrmdocker
CLI to manage Multi-tenant deployments for Frappe apps
★ 1,680Pythonupdated 2026-04-11clifrappe-benchfrappe-frameworkpythonsetup-bench
Free Bootstrap Admin & Dashboard Template Built for AI-Assisted Development
★ 12,211HTMLupdated 2026-03-28adminadmin-dashboardadmin-paneladmin-templateadmin-theme
Dropbase helps developers build and prototype web apps faster with AI. Dropbase is local-first and self hosted.
★ 1,277Pythonupdated 2024-09-27
The Postgres development platform. Supabase gives you a dedicated Postgres database to build your web, mobile, and AI applications.
★ 101,440TypeScriptupdated 2026-04-20aialternativeauthdatabasedeno
Noodl is a low code platform for creating full stack web applications
★ 542TypeScriptupdated 2024-07-18app-buildereditorjavascriptlow-codelow-code-platform
Athens is no longer maintainted. Athens was an open-source, collaborative knowledge graph, backed by YC W21
★ 6,303Clojureupdated 2023-02-03hacktoberfestknowledge-baseknowledge-graphknowledge-managementmemex
An easy and fast way to create a Python GUI 🐍
★ 10,231Pythonupdated 2026-03-13automaticcollaboratedrag-and-dropeasyeasy-to-use
PAGE is a drag-and-drop GUI generator for Python and Tkinter aimed at building Python modules which can display a relatively simple GUI constructed from Tk and ttk widget sets using the Place Geometry Manager. (Copy of page-4.2.3.tgz (2014-04-13) Source from:
★ 6Tclupdated 2014-04-19
Grist is the evolution of spreadsheets.
★ 10,994TypeScriptupdated 2026-04-20awesomedatabasespreadsheet
SeaTable: easy like a spreadsheet, powerful like a database. Unlimited rows in a single base.
★ 699updated 2025-11-12airtabledatabaseexcelonline-lightweight-databasespreadsheet
🚀🎉📚 APITable, an API-oriented low-code platform for building collaborative apps and better than all other Airtable open-source alternatives.
★ 15,320TypeScriptupdated 2025-10-30admin-dashboardairtableairtable-alternativeapiautomatic-api
A highly-configurable, distributed, realtime database that manages a state tree shared among many peers.
★ 918Goupdated 2023-03-07badgerbadgerdbblockchainbraidbraid-protocol
A code generation tool for Laravel developers.
★ 3,108PHPupdated 2026-02-20
🔥 🔥 🔥 The Open Source Retool Alternative
★ 6,216TypeScriptupdated 2023-10-19admin-dashboardapp-builderapp-developmentbusiness-intelligenceclickhouse
An open source headless CMS / real-time database. Powerful table editor, full-text search, and SDKs for JS / React / Svelte.
★ 1,536TypeScriptupdated 2026-04-19actixatomic-dataclidatabaselibrary
Server ecosystem for Standard Notes; fully self-hostable.
★ 453TypeScriptupdated 2026-04-11
A curated list of tools and information relating to Standard Notes.
★ 944updated 2026-02-01awesomeawesome-liststandard-notes
Think fearlessly with end-to-end encrypted notes and files. For issues, visit https://standardnotes.com/forum or https://standardnotes.com/help.
★ 6,425TypeScriptupdated 2026-04-16encryptedevernotemarkdownnote-takingnotes
The new Turtl server
★ 635JavaScriptupdated 2024-03-25
Build your personal knowledge base with TriliumNext Notes
★ 2,924TypeScriptupdated 2025-06-24documentation-toolelectronknowledge-graphknowledgebaselocal-first
A curated list of amazingly awesome articles, people, applications, software libraries and projects related to the knowledge management space
★ 825updated 2025-03-14awesomeawesome-listgraph-databaseknowledge-graphknowledge-management
Laravel is a web application framework with expressive, elegant syntax. We’ve already laid the foundation for your next big idea — freeing you to create without sweating the small things.
★ 84,076Bladeupdated 2026-04-16frameworklaravelphp
A set of beautifully-designed, accessible components and a code distribution platform. Works with your favorite frameworks. Open Source. Open Code.
★ 113,008TypeScriptupdated 2026-04-20base-uicomponentslaravelnextjsradix-ui
Lightweight document management system packed with all the features you can expect from big expensive solutions
★ 2,545JavaScriptupdated 2026-02-09clouddmsdockerdocumententerprise
📦 The official Nextcloud installation method. Provides easy deployment and maintenance with most features included in this one Nextcloud instance.
★ 9,614PHPupdated 2026-04-20backupdockernextcloudrestore
Kazam2 - Linux Screen Recorder, Broadcaster, Capture and OCR with AI in mind
★ 375Pythonupdated 2025-02-12
Directus Init is a preconfigured Directus install with PostgreSQL - intended for extension development or self-hosting
★ 19HTMLupdated 2024-02-12directusdirectus-extensionheadless-cmsjavascriptnodejs
The flexible backend for all your projects 🐰 Turn your DB into a headless CMS, admin panels, or apps with a custom UI, instant APIs, auth & more.
★ 34,915TypeScriptupdated 2026-04-20apiappcmscomposabledata-visualization
★ 38TypeScriptupdated 2024-09-27
A full-featured, open-source content management framework built with Node.js that empowers organizations by combining in-context editing and headless architecture in a full-stack JS environment.
★ 4,551JavaScriptupdated 2026-04-17apostrophecmscms-frameworkjamstackjavascript
AdminLTE - Free admin dashboard template based on Bootstrap 5
★ 45,371CSSupdated 2026-04-15adminadmin-dashboardadmin-dashboard-templateadmin-dashboard-uiadmin-panel
A frontend Framework for single-page applications on top of REST/GraphQL APIs, using TypeScript, React and Material Design
★ 26,654TypeScriptupdated 2026-04-17adminadmin-dashboardadmin-on-restadmin-uifrontend-framework
A free data masking and/or anonymizer library
★ 146C#updated 2025-03-30data-maskingsql-server
Prompt chains maximize intelligence and results when using LLMs
★ 1,198updated 2025-01-17
The open-source Linktree alternative.
★ 580TypeScriptupdated 2023-03-07apollographqljavascriptlinktreelinktree-alternative
This repository showcases various advanced techniques for Retrieval-Augmented Generation (RAG) systems. Each technique has a detailed notebook tutorial.
★ 26,982Jupyter Notebookupdated 2026-04-15aiembeddingslangchainllama-indexllm
A Linux compatible UI for the Elgato Stream Deck.
★ 409Pythonupdated 2026-03-06
An open source library for deep learning end-to-end dialog systems and chatbots.
★ 6,975Pythonupdated 2025-08-06aiartificial-intelligencebotchatbotchitchat
Inference code for Llama models
★ 59,367Pythonupdated 2025-01-26
The fastest knowledge base for growing teams. Beautiful, realtime collaborative, feature packed, and markdown compatible.
★ 38,273TypeScriptupdated 2026-04-20dockerjavascriptmobxnodejsreact
A platform to create documentation/wiki content built with PHP & Laravel
★ 18,713PHPupdated 2026-04-20bookstackdocumentationlaravelphpselfhosted
Build your personal knowledge base with Trilium Notes
★ 35,738TypeScriptupdated 2026-04-20electronelectron-appknowledge-baseknowledge-graphknowledge-management
Markdown All in One
★ 3,210TypeScriptupdated 2026-04-16markdownvscode
Joplin - the privacy-focused note taking app with sync capabilities for Windows, macOS, Linux, Android and iOS.
★ 54,500TypeScriptupdated 2026-04-20androiddropboxelectronenex-filesevernote
Create your own Component structure with a simple click.
★ 236TypeScriptupdated 2025-02-11
CLI tool for running Yeoman generators
★ 3,957JavaScriptupdated 2026-04-09generatorjavascriptnodejsscaffoldingtemplates
Robust Speech Recognition via Large-Scale Weak Supervision
★ 98,410Pythonupdated 2026-04-15
Backup GitHub repo(s) to Backblaze B2
★ 3Shellupdated 2018-06-07
Backup all your github & gitlab repositories
★ 290Goupdated 2025-04-03backupgithubgitlab
Back up your Github repositories
★ 112Rubyupdated 2020-02-29
A backup script for GitHub repositories
★ 79Pythonupdated 2024-03-03
GitHub Enterprise Backup Utilities
★ 1,262updated 2026-02-28backupsgithub-enterprise
Generate any file structure - from single components to entire app boilerplates, with a single command.
★ 61TypeScriptupdated 2026-04-06clifilefilesgeneratorjavascript
Aliyah Tips for people who are planning their move to Israel
★ 1Shellupdated 2017-11-12
:white_check_mark: Validate links in awesome projects
★ 890Rubyupdated 2023-04-20awesomecicircleciclidanger
Pointers to useful, well-written, and otherwise beautiful documentation.
★ 9,485updated 2026-03-03beautifulbeautiful-docsdevdeveloperdoc
:fire: :books: All the tools, processes and resources you need to create an awesome API & Project documentation
★ 217updated 2026-03-11apiapi-documentationawesomeawesome-listblueprint
📃 A curated and up-to-date list of resources on software documentation templates, tools, guides, examples, etc.
★ 130Pythonupdated 2026-03-01api-docsawesomeawesome-listdiagrammingdocs
A curated list of awesome Read the Docs projects
★ 210updated 2024-06-19awesomeawesome-listdocumentationread-the-docs
A curated list of awesome documentation websites ✍️💯
★ 49updated 2026-03-11accessiblityawesome-listbest-practicesdocsdocumentation
A page of examples of awesome documentation
★ 43updated 2019-03-26
A free and open-source library of AI prompts.
★ 30Svelteupdated 2023-10-06chatgptchatgpt-promptchatgpt-prompts
Automate ChatGPT prompt input from Airtable data
★ 32JavaScriptupdated 2023-03-07airtableairtable-extensionchatgptopenaiopenai-api
Discover the ultimate collection of top AI prompts for ChatGPT, Bard, and beyond. Elevate your prompt skills with this open-source project. Unleash the full potential of AI-driven interactions. 🔥
★ 33JavaScriptupdated 2023-07-13aibardchatgptjavascriptnextjs
吴恩达《ChatGPT Prompt Engineering for Developers》课程中文版
★ 84Jupyter Notebookupdated 2023-04-28
Prompt Engineering for Everybody with ChatGPT and GPT4, by Packt Publishing
★ 32updated 2023-11-17
A playground of highly experimental prompts, Jinja2 templates & scripts for machine intelligence models from OpenAI, Anthropic, DeepSeek, Meta, Mistral, Google, xAI & others. Alex Bilzerian (2022-2025).
★ 1,574Jinjaupdated 2025-07-12ai-agentsjinjajinja2-templatesmeta-promptingmultimodal
Here is over 200 AI prompts that covers Blog Writing, Email Marketing , YouTube Ad Scripts, Facebook Ad,YouTube Video Ideas,Twitter Thread ,Cold DM Ideas,Influencer Marketing and Copywriting and Instagram Story.
★ 114updated 2023-02-08aibardbingchatgptchatgpt3
This is my collection of helpful priming prompts for ChatGPT when discussing various angles of software development and architecture.
★ 154updated 2023-11-24aiarchitecturechatgptchatgpt-promptchatgpt-prompts
SourceGPT - prompt manager and source code analyzer built on top of ChatGPT as the oracle
★ 109Pythonupdated 2023-04-14chatgptopenai
Convert a Git repo into a ChatGPT prompt!
★ 172Goupdated 2025-09-26chatgptgogolanggptgpt-3
List of prompts for chatGPT for various assistances with tasks.
★ 42updated 2024-11-14chatgptopenai
A collection of prompts for use with GPT-4 via ChatGPT, OpenAI API w/ Gradio frontend & notebook
★ 195Jupyter Notebookupdated 2023-08-08chatgptgpt-3gpt-4gradiolangchain
This shows the results from using a second, filter LLM that analyses prompts before sending them to GPT-Chat
★ 108updated 2022-12-06
Welcome to the ChatGPT Prompts Library! This repository contains a diverse collection of over 100,000 prompts tailored for ChatGPT. Our prompts cover a wide range of topics, including marketing, business, fun, and much more.
★ 240updated 2023-11-23aibardbard-promptschatgptchatgpt-prompt
Official Implementation of InstructZero; the first framework to optimize bad prompts of ChatGPT(API LLMs) and finally obtain good prompts!
★ 199Pythonupdated 2024-07-23black-box-optimizationblack-box-tuningchatgptinstruction-optimizationlarge-language-model
A CLI tool to convert your codebase into a single LLM prompt with source tree, prompt templating, and token counting.
★ 7,302Rustupdated 2026-04-14aichatgptclaudeclicommand-line
ChatGPT page with API instand of offical pages. You can modify params, save and download the result as txt with prompt.
★ 138Vueupdated 2023-02-22chatgptvuevue3
ChatGPT Desktop Application with prompts hint and voice control
★ 64JavaScriptupdated 2023-04-07aichatgptdesktop-appgptgpt-3
📊 llm.report is an open-source logging and analytics platform for OpenAI: Log your ChatGPT API requests, analyze costs, and improve your prompts.
★ 1,017TypeScriptupdated 2024-05-14aiopsgpt-3gpt-4llmllmops
Harness GPT's expertise with curated prompts for consistent, high-quality professional consultations.
★ 122updated 2023-06-20aichatgptgptllmprompt
A reference containing useful prompts for ChatGPT. Many prompts have parameters that allow you to customize them to your liking.
★ 82updated 2023-03-19
ChatGPT Jailbreaks, GPT Assistants Prompt Leaks, GPTs Prompt Injection, LLM Prompt Security, Super Prompts, Prompt Hack, Prompt Security, Ai Prompt Engineering, Adversarial Machine Learning.
★ 3,864HTMLupdated 2026-03-06adversarial-machine-learningagentaiassistantchatgpt
some prompt about cyber security
★ 306updated 2023-07-13
Using Tree-of-Thought Prompting to boost ChatGPT's reasoning
★ 818updated 2023-12-09large-language-modelsllmprompt-engineering
One-Click-Deploy Your Own Advanced ChatGPT-prompts-database by Vercel🙌一键部署个人Prompts的数据库,除了Prompts,还有Prompting Engineer的相关资料!
★ 78JavaScriptupdated 2024-11-13chatgptchatgpt-prompt-engineeringchatgpt-promptsdockerprompt-engineering
This repo includes Claude prompt curation to use Claude better.
★ 4,932updated 2026-02-28anthropicanthropic-claudeawesome-claudeawesome-claude-promptsawesome-prompts
Awesome ChatGPT prompts for engineers😇
★ 169updated 2023-10-28
This repo includes ChatGPT content creation prompt curation to use ChatGPT for content creation better.
★ 125HTMLupdated 2023-04-11chatgptcontent-creation
Advanced ChatGPT Prompts
★ 61updated 2023-05-28
Prompts for playable games in ChatGPT
★ 310updated 2024-01-08
Instruction-based prompts for generating and classifying text.
★ 533updated 2025-11-13chatgptchatgpt-promptsgpt-3gpt-3-promptgpt-3-prompts
ChatGPT Prompts for Devops Mastery
★ 71updated 2025-01-21
ChatGPT Desktop Application Supercharged with prompts
★ 101JavaScriptupdated 2023-08-31appchatchatgptelectrongenerative
Jupyter code notebooks of "ChatGPT Prompt Engineering for Developers" by DeepLearning.AI and OpenAI.
★ 401Jupyter Notebookupdated 2023-04-29chatgptexpandinginferringlarge-language-modelssummarizing
Prompt Engineering, Generative AI, and LLM Guide by Learn Prompting | Join our discord for the largest Prompt Engineering learning community
★ 4,688MDXupdated 2025-01-14chatgptchatgpt-apideep-learninggpt-3gpt-4
Free prompt engineering online course. ChatGPT and Midjourney tutorials are now included!
★ 5,318CSSupdated 2023-09-17promptprompt-engineeringprompt-toolkit
Here are the prompts I’ve created and want to share.
★ 261updated 2023-03-26
收集GPTS的prompt / Collect the prompt of GPTS
★ 1,784updated 2025-12-24chatgptchatgpt-apigptsgptslistprompt
ChatGPT PROMPTs Splitter. Tool for safely process chunks of up to 15,000 characters per request
★ 565Pythonupdated 2024-02-28ai-conversationscharacter-limitchatgptlanguage-modelnlp-tool
LangGPT: Empowering everyone to become a prompt expert! 🚀 📌 结构化提示词(Structured Prompt)提出者 📌 元提示词(Meta-Prompt)发起者 📌 最流行的提示词落地范式 | Language of GPT The pioneering framework for structured & meta-prompt design 10,000+ ⭐ | Battle-tested by thousands of users worldwide Created by 云中江树
★ 11,976Jupyter Notebookupdated 2026-01-30chatgptclaudedeeplearningdoubaoframework
ChatGPT and Bing AI prompt curation
★ 897updated 2025-06-11aiartificial-intelligencebingchatbotchatgpt
In the evolving world of Large Language Models (LLMs), crafting effective prompts has become an essential skill. That's why I've created this collection, showcasing the most impactful prompts of the year across various intriguing domains. 🌐
★ 1,483updated 2023-12-13chatgptpromptsprompts-template
This repository contains a collection of the best system prompts for ChatGPT, a conversational AI model developed by OpenAI. Star this repository to help us reach 5,000 stars!
★ 1,200updated 2024-12-11chatgptgpt4openai
ChatGPT with superpowers! Search chat history, create folders, export all chats, pin messages, access thousands of community prompts, incognito mode, language and tone selection, and many more features
★ 1,669JavaScriptupdated 2024-06-18chrome-extensionfirefox-addonfirefox-extensionproductivity
Curate a custom library of AI Prompts
★ 1,277JavaScriptupdated 2026-02-17aibrowser-extensionchatgptchrome-extension
A VSCode extension that generates README.md files
★ 11TypeScriptupdated 2025-11-18readme-bolierplatereadme-generatorreadme-templatevscode-extension
📢 Various README templates & tips on writing high-quality documentation that people want to read.
★ 5,953updated 2025-10-31awesomedocsdocumentationdocumentation-templatedocumentation-theme
ChatGPT-generated Python scripts for various purposes
★ 1updated 2024-08-08
An index of prompting libraries for GPTs, including ChatGPT. Some of these are on Github and others are hosted externally.
★ 45updated 2024-11-21
Utility for identifying newly released custom ChatGPTs shared via the ChatGPT App Store
★ 2updated 2024-08-07
An admin application I'm developing for managing all aspects of working with LLMs professionally and at scale, with functions for prompt logging, prompt library, and custom LLM agent inventorising. Aspiration: add code to notes gradually as project matures!
★ 3Pythonupdated 2024-09-26
DSPy: The framework for programming—not prompting—language models
★ 34,007Pythonupdated 2026-04-17
A collection of prompts, system prompts and LLM instructions
★ 5,002HTMLupdated 2026-02-21
f.k.a. Awesome ChatGPT Prompts. Share, discover, and collect prompts from the community. Free and open source — self-host for your organization with complete privacy.
★ 160,697HTMLupdated 2026-04-20aiartificial-intelligenceawesome-listchatgptchatgpt-prompts
A curated list of awesome resources, tools, and other shiny things for LLM prompt engineering.
★ 1,565Pythonupdated 2026-02-23awesomeawesome-listawesome-listsawesome-readmeawesome-resources
This repository contains a hand-curated resources for Prompt Engineering with a focus on Generative Pre-trained Transformer (GPT), ChatGPT, PaLM etc
★ 5,820TypeScriptupdated 2026-04-20chatgptchatgpt-apideep-learningfew-shot-learninggpt
🍰 PromptLayer - Maintain a log of your prompts and OpenAI API requests. Track, debug, and replay old completions.
★ 759Pythonupdated 2026-04-17gptmachine-learningopenaipromptprompt-engineering
Simple express app for practicing express-validator implementation and fundamental express features
★ 1JavaScriptupdated 2024-08-08
Download and convert all online images to local images in markdown files.
★ 67Pythonupdated 2025-08-27
🚀 Curated collection of Amazing Python scripts from Basics to Advance with automation task scripts.
★ 3,530Jupyter Notebookupdated 2026-02-20artificial-intelligencehacktoberfestmachine-learningprojectspython
because i'm tired of gists
★ 2,159Pythonupdated 2023-04-14
A template with boilerplate structure for Hashnode's Github as source feature
★ 27updated 2023-06-14
An opinionated backend framework based on NestJS. Get your CRUD app up and running in no time! ⚙️🔒
★ 813TypeScriptupdated 2026-03-03authenticationauthorizationbackendcaslcrud
Building a fully featured and localized voice assistant for Linux
★ 152Javaupdated 2026-03-26assistentjavalinuxpvavoice
Mycroft Core, the Mycroft Artificial Intelligence platform.
★ 6,623Pythonupdated 2024-09-08aiarchartificial-intelligencefedorahacktoberfest
Easily add GeoJson layers to your Maps
★ 151Javaupdated 2021-06-01androidandroid-applicationandroid-librarygeojsonlibrary
A Simple Python script simplifies the creation of README.md files for projects.
★ 1Pythonupdated 2024-07-01python3script
A repository of prompts I've used when working with LLMs as well as some example outputs and notes
★ 9updated 2024-12-07gptllmsprompt-engineeringprompt-tuningprompting
Great online communities discussing use of LLMs including (but not limited to) ChatGPT
★ 3updated 2024-11-21
LLM-generated documents describing potential use-cases for GPTs & other LLMs across both professional and business contexts with sections describing potential/predicted evolutions as underlying technology advances
★ 1updated 2024-11-28
🤗 Transformers: the model-definition framework for state-of-the-art machine learning models in text, vision, audio, and multimodal models, for both inference and training.
★ 159,926Pythonupdated 2026-04-20audiodeep-learningdeepseekgemmaglm
Label Studio is a multi-type data labeling and annotation tool with standardized output format
★ 27,135TypeScriptupdated 2026-04-20annotationannotation-toolannotationsboundingboxcomputer-vision
A privacy-first, open-source platform for knowledge management and collaboration. Download link: http://github.com/logseq/logseq/releases. roadmap: https://logseq.io/p/NX4mc_ggEV
★ 42,414Clojureupdated 2026-04-20clojureclojurescriptgitgraphknowledge-base
An unofficial userspace driver for HID++ Logitech devices
★ 4,220C++updated 2025-12-29hidlinuxlogitechlogitech-keyboardslogitech-mouse
★ 429Jupyter Notebookupdated 2025-05-27
אזרחים למען ערים!
★ 5JavaScriptupdated 2017-08-17
Opentrain repository for community data analysis of Israel Railways train delay data.
★ 25HTMLupdated 2023-01-13
Main repository for Open Knesset project - contains the knesset data scrapers and processing pipelines
★ 19Jupyter Notebookupdated 2026-03-25
Tool that generates realistic mock data for Israel oriented use-cases
★ 3Pythonupdated 2024-07-02
:chart_with_upwards_trend: Open Pension is a "Hasadna" project, that aimed to revealing the secrets behind the Israeli pension market.
★ 17TypeScriptupdated 2024-10-24
★ 1HTMLupdated 2025-02-14
Open Data Portals and Sites around the world
★ 162Nunjucksupdated 2026-04-08csvjsonmetadataopen-dataopen-datasets
Open Definition source
★ 137HTMLupdated 2025-09-12jekylllicenseslicensingopen-dataopendata
A continuation of HomeBox the inventory and organization system built for the Home User
★ 5,845Goupdated 2026-04-19hacktoberfesthomeboxinventoryselfhosted
Display and control your Android device
★ 139,017Cupdated 2026-04-19androidcffmpeglibavmirroring
A Python module to read/write NFC tags or communicate with another NFC device.
★ 633Pythonupdated 2024-05-28nfcnfc-librarypythonpython-library
OpenFace – a state-of-the art tool intended for facial landmark detection, head pose estimation, facial action unit recognition, and eye-gaze estimation.
★ 7,636MATLABupdated 2024-06-01
Instruct-tune LLaMA on consumer hardware
★ 18,943Jupyter Notebookupdated 2024-07-29
A Gtk/Qt front-end to tesseract-ocr.
★ 1,941C++updated 2026-01-15c-plus-plusgtkhocrhocr-documentsocr
A program to recognize text on the screen
★ 292C++updated 2026-04-19ocrtesseracttesseract-ocr
Tesseract Open Source OCR Engine (main repository)
★ 73,725C++updated 2026-04-19hacktoberfestlstmmachine-learningocrocr-engine
Free Open Source Enterprise Grade RPA
★ 2,933C#updated 2026-04-15automationmultiple-robotsopenflowrparpa-robots
This Python script is designed to track music played on Home Assistant media players. It stores track information in a SQLite database and provides various statistics
★ 5Pythonupdated 2025-07-19
A DBus daemon to configure input devices, mainly high-end and gaming mice
★ 2,485Cupdated 2026-01-11hacktoberfest
Guides, notebooks and resources for prompt engineering
★ 4MDXupdated 2024-02-11
★ 428JavaScriptupdated 2024-08-13
Promptimize is a prompt engineering evaluation and testing toolkit.
★ 494Pythonupdated 2026-03-16
Prompt Engineering | Prompt Versioning | Use GPT or other prompt based models to get structured output. Join our discord for Prompt-Engineering, LLMs and other latest research
★ 4,588Pythonupdated 2026-03-27chatgptchatgpt-apichatgpt-pythongpt-3gpt-3-prompts
awesome for your to collections
★ 26updated 2023-03-30awesome-listprompt-engineering
★ 151updated 2025-02-24
All things prompt engineering
★ 5,741Pythonupdated 2024-06-04
A library for helping developers craft prompts for Large Language Models
★ 2,748TypeScriptupdated 2023-04-25
★ 5updated 2023-08-28
Tips and tricks for working with Large Language Models like OpenAI's GPT-4.
★ 9,533updated 2023-10-23
🐙 Guides, papers, lessons, notebooks and resources for prompt engineering, context engineering, RAG, and AI Agents.
★ 73,813MDXupdated 2026-03-11agentagentsai-agentschatgptdeep-learning
★ 122Astroupdated 2026-03-18
A high performance blog template for the 11ty static site generator.
★ 4,047JavaScriptupdated 2024-06-1811ty11ty-templateeleventy
Starter site for creating a responsive image gallery using the Eleventy static site generator
★ 180SCSSupdated 2026-04-0911tyeleventyphoto-gallerytemplate
kaldi-asr/kaldi is the official location of the Kaldi project.
★ 15,378Shellupdated 2025-09-22c-plus-pluscudakaldishellspeaker-id
★ 77Jupyter Notebookupdated 2025-10-04
OpenAPI specification for the OpenAI API
★ 2,367updated 2025-06-17openaiopenai-api
Self-hostable link database and RSS reader
★ 139Pythonupdated 2026-04-06bookmark-managerdead-internetlink-aggregationlink-aggregatorlink-archive
Bookmark manager for the wizards 🧙
★ 2,790TypeScriptupdated 2026-03-07bookmarksbookmarks-managerdockerself-hostedsvelte
A full-featured package manager and viewer for Android
★ 7,889Javaupdated 2026-04-16adbandroidapksmaterial-designpackage-manager
Simple bookmark manager built with Go
★ 11,434Goupdated 2026-02-01bookmark-managercommand-linegogolanghacktoberfest
Espial is an open-source, web-based bookmarking server.
★ 885Haskellupdated 2025-05-23bookmarkbookmarking-serverdatabasedemohaskell
Self-hosted bookmark manager that is designed be to be minimal, fast, and easy to set up using Docker.
★ 10,512Pythonupdated 2026-04-07bookmark-managerbookmark-servicebookmarksself-hosted
⚡️⚡️⚡️ Self-hosted collaborative bookmark manager to collect, read, annotate, and fully preserve what matters, all in one place.
★ 18,096TypeScriptupdated 2026-04-01bookmarkbookmark-managercollaborationnextjsreact-native
Minimalistic flexible homepage
★ 695TypeScriptupdated 2025-10-26applicationdashboarddockerhomepageproductivity
Clean and functional startpage for firefox and chrome with material gruvbox style
★ 316JavaScriptupdated 2023-11-19animechromefirefoxgithub-pagegruvbox
Second Implementation of a Startpage for my browser in Next.js using Typescript and Tailwind.css with Motion Animations and More
★ 13TypeScriptupdated 2023-10-27
A custom new tab page, keeping all the best info handy (a work in progress, feedback is invaluable)
★ 411TypeScriptupdated 2025-10-17gmailnextjsoutlookreactspotify
A simple and clean startpage 🌟
★ 285JavaScriptupdated 2023-09-19cardsfasthomepagehtmljs
Big buttons with easy click startpage for a browser.
★ 216JavaScriptupdated 2022-03-03binancecrypto-chartcss-gridnewsapiopenweather
New tab browser extension (aka startpage) with nord colors and a dancing goose.
★ 25TypeScriptupdated 2023-04-13
A custom startup page for your browser.
★ 514JavaScriptupdated 2024-04-23homepagelanding-pagelandingpagereactstartpage
My daily homepage
★ 13CSSupdated 2022-03-15startpage
A minimalistic custom browser startpage that can be configured to your needs.
★ 39TypeScriptupdated 2021-12-02
Fluidity - An accordion based startpage
★ 354TypeScriptupdated 2026-04-16emotionjsgithub-pagereactstartpagetypescript
Terminal-inspired, clean, feature-rich and customizable browser start page for geeks. Has built-in editor for customizing.
★ 733JavaScriptupdated 2025-04-05browserbrowser-start-pagecustomizabledockerjavascript
The minimalist, elegant and hackable startpage.
★ 2,173JavaScriptupdated 2025-04-21bentofeather-iconsnewtabnewtabpageopen-source
a startpage for your server and / or new tab page
★ 1,570JavaScriptupdated 2024-08-02
HTPC/Homelab Services Organizer - Written in PHP
★ 5,743PHPupdated 2026-03-06bookmarkchatcouchpotatocouchpotatoserverdashboard
An Application dashboard and launcher
★ 9,133PHPupdated 2025-11-11application-dashboardbookmarkcouchpotatodashboardemby
The personal, minimalist, super-fast, database free, bookmarking service - community repo
★ 3,845PHPupdated 2026-03-26bookmarkingbookmarksbookmarks-managerself-hosted
This is a carefully compiled list of remarkable projects with the focus on startpages.
★ 1,235updated 2026-04-14awesomeawesome-listchromefirefoxhacktoberfest
Flame is self-hosted startpage for your server. Easily manage your apps and bookmarks with built-in editors.
★ 6,313TypeScriptupdated 2024-07-03homepageself-hostedstartpage
A very simple static homepage for your server.
★ 11,296Vueupdated 2026-04-18dashboardhacktoberfesthomepageself-hostedtoolbox
Generate Markdown tables from CSV data online.
★ 17JavaScriptupdated 2022-12-08
📝📊 Convert your CSV files into Markdown tables.
★ 667Pythonupdated 2020-04-27csv-filesmarkdownpython
Official website of the Markdownizr chrome extension
★ 55HTMLupdated 2018-06-15
Display URLs, emails and phone numbers as links in Directus
★ 67TypeScriptupdated 2025-01-16directusdirectus-extensiondirectus-extension-displaylinklinks
Mirror of
★ 493Pythonupdated 2022-10-26distraction-freegtkmarkdownmarkdown-editorpython
AutoGPT is the vision of accessible AI for everyone, to use and to build on. Our mission is to provide the tools, so that you can focus on what matters.
★ 183,763Pythonupdated 2026-04-20agentic-aiagentsaiartificial-intelligenceautonomous-agents
A list of AI autonomous agents
★ 27,483updated 2025-02-26agentaiartificial-intelligenceautogptautonomous-agents
KDE Plasma Screen Splitting Shortcuts ideal for Ultrawide and Super-Ultrawide Monitors
★ 232JavaScriptupdated 2026-02-02kdekde-plasmakde-plasma-5kde-plasma-6tiling
🖖 Vue.js is a progressive, incrementally-adoptable JavaScript framework for building UI on the web.
★ 53,524TypeScriptupdated 2026-04-20
Template of a business landing page to be configured by json file
★ 55Astroupdated 2024-03-15
Gmail Unsubscriber is a Google Apps Script for unsubscribing from unwanted newsletters and other bulk emails.
★ 1,558JavaScriptupdated 2025-04-04gmailgoogle-apps-scriptgoogle-sheetsgoogle-workspace
My personal homepage - based on the Milky Way Astro theme by Tristen Tomczak
★ 1Astroupdated 2024-10-28
One app to rule them all!
★ 1,681TypeScriptupdated 2025-04-22browserelectronsaas
Integration to add Decap CMS’s admin dashboard to any Astro project
★ 22TypeScriptupdated 2024-05-02
Internal tools and workflow automations
★ 287Shellupdated 2025-12-19admin-dashboardadmin-paneladmin-uiapp-builderdeveloper-tools
A list of software that turns your database into a REST/GraphQL API
★ 2,095Goupdated 2025-03-30automatic-apigraphqlgraphql-apilistrest
Qr code generation and display
★ 2Svelteupdated 2023-11-02
★ 180Astroupdated 2024-05-12
:rocket: GraphQL API for WordPress
★ 3,776PHPupdated 2026-04-20apigatsbygraphqlgraphql-apigraphql-php-library
A library which provides extended functionality to WordPress custom post types and taxonomies.
★ 1,022PHPupdated 2025-08-28maintainer-wantedwordpress
An Accessible, WCAG compliant Starter Theme for Astro 5+ including several accessibility features such as, better focus-outline, landmarks, semantics, interactive components and skip-link navigation. Ships with Tailwind 4, Prettier and ESLint support.
★ 1,143Astroupdated 2026-04-03a11yaccessibilityastroblogdarkmode
🚀 Astro boilerplate with responsive blog and portfolio template using TypeScript and React styled with Tailwind CSS ⚡️ Made with developer experience first: TypeScript + ESLint + Prettier + Husky + Lint-Staged + Commitlint + VSCode
★ 909TypeScriptupdated 2025-08-31blogboilerplateboilerplate-front-endboilerplate-templatejamstack
Makes it easy to add information that is relevant for SEO to your Astro app.
★ 1,317Astroupdated 2026-01-14astroseo
A minimalist portfolio template with a whimsical charm, designed to showcase your creativity in an elegant digital space.
★ 245Astroupdated 2025-04-02astroastro-templateastro-themesboilerplatedark-mode
The most powerful solution for importing XML and CSV files to WordPress. Import to Posts, Pages, and Custom Post Types. Support for imports that run on a schedule, ability to update existing imports, and much more.
★ 11PHPupdated 2020-09-16
10up WordPress project scaffold.
★ 292JavaScriptupdated 2026-04-16
Full Width Page Template for Any WordPress Theme.
★ 15PHPupdated 2026-03-13
A more intuitive way to manage pages and content structure in the WordPress admin
★ 192PHPupdated 2025-05-21
HTML tables with support for rowspan and colspan, with string keys for rows and columns, generated with PHP.
★ 48PHPupdated 2024-11-01colspanhtml-tablephprowspantbody
Inactive project – please visit https://themeshaper.com/block-themes/ to learn more about the future of WordPress themes with Block Themes.
★ 10,996CSSupdated 2025-09-05
★ 27PHPupdated 2019-07-19
Create WordPress themes with beautiful OOP code and the Twig Template Engine
★ 5,652PHPupdated 2026-04-20hactoberfestphptimbertwigupstatement
🔐 Share end-to-end encrypted secrets with others via a one-time URL
★ 1,843Goupdated 2025-02-08cliend-to-end-encryptionsecret-managementsecret-sharing
ToolJet is the open-source foundation of ToolJet AI - the enterprise app generation platform for building internal tools, dashboard, business applications, workflows and AI agents 🚀
★ 37,796JavaScriptupdated 2026-04-20ai-app-builderdockerhacktoberfestinternal-applicationsinternal-project
PostgreSQL for WordPress (PG4WP) gives you the possibility to install and use WordPress with a PostgreSQL database as a backend.
★ 17updated 2013-12-02
OliveTin gives safe and simple access to predefined shell commands from a web interface.
★ 3,520Goupdated 2026-04-19apicontainerhomeautomationlinuxmaturity-prod
Streamlit — A faster way to build and share data apps.
★ 44,356Pythonupdated 2026-04-20data-analysisdata-sciencedata-visualizationdeep-learningdeveloper-tools
A curated list of Budibase plugins 🔌 including data sources and components.
★ 246updated 2026-02-03apicomponent-librarycomponentscrud-applicationdatabase
:memo: An awesome Data Science repository to learn and apply for real world problems.
★ 28,891updated 2026-04-18analyticsawesome-listdata-miningdata-sciencedata-scientists
A curated list of awesome Chart.js resources and libraries
★ 2,656updated 2026-03-23awesomechartjschartsintegrationsplugins
List of PostgreSQL® AI projects and resources
★ 92updated 2025-08-19aimachine-learningpostgresql
data load tool (dlt) is an open source Python library that makes data loading easy 🛠️
★ 5,254Pythonupdated 2026-04-20datadata-engineeringdata-lakedata-loadingdata-warehouse
Remove text from AI-generated images
★ 308Pythonupdated 2024-10-25
Cross OS WordPress local development environment
★ 12Shellupdated 2025-10-14
Install and manage a high performance WordPress stack with a few keystrokes
★ 1,545Pythonupdated 2026-03-31automationcacheclidebianlemp
A curated list of all things awesome about OpenAI
★ 54Jupyter Notebookupdated 2024-07-19artificial-intelligencejavascriptjsonnlp-machine-learningopenai
A curated list of Artificial Intelligence Top Tools
★ 4,992updated 2025-12-31aiai-agentai-agentsai-assistantai-tools
Independent astro components
★ 18Astroupdated 2023-11-20
A collection of accessible components for Astro projects with built-in ARIA attributes, keyboard navigation and interactive elements. Easy to implement and customize to your needs.
★ 539Astroupdated 2026-03-08a11yaccessibilityastrocomponentscss
Starlight plugin adding zoom capabilities to your documentation images
★ 113TypeScriptupdated 2026-03-12documentationimageimage-zoomstarlightzoom
🐍 A Python GUI for postgreSQL built with tkinter
★ 4Pythonupdated 2019-07-07
🌀 Rapidly build feature-rich data portals using a modern frontend framework. Native CKAN support. OpenMetadata and Git compatible.
★ 2,273TypeScriptupdated 2026-03-30ckandata-fabricdata-management-platformdata-meshdata-portal
:package: Bugs, issues and suggestions for datahub.io
★ 32updated 2026-01-06
ISO 4217 List of Currencies and Currency Codes
★ 176Shellupdated 2026-03-03
Deploy a no-code admin panel for any application in less than a minute. Search, create, update, and delete data entries, create custom actions, and build reports.
★ 2,161Rubyupdated 2024-05-30admin-dashboardadmin-panelbusiness-ingelligencemysqlno-code
Admin panel builder / CRUD generator for Laravel.
★ 990PHPupdated 2024-11-27cmscraftablecrudlaravelphp
A golang framework helps gopher to build a data visualization and admin panel in ten minutes
★ 8,949Goupdated 2025-06-24adminadminltebeegodatavisualizationdataviz
Open source PostgreSQL GUI client for macOS, Linux and Windows
★ 1,623JavaScriptupdated 2025-06-30desktop-appelectron-appjavascriptlinuxmacos
Python GUIs for Humans! PySimpleGUI is the top-rated Python application development environment. Launched in 2018. NEW for 2026 - the LGPL3 Version 6. Transforms tkinter, Qt, WxPython, and Remi into a simple, intuitive, and fun experience for both hobbyists and expert users.
★ 13,705Pythonupdated 2026-04-16beginner-friendlydatavisualizationgamesguigui-framework
Web-based SQL editor
★ 5,187JavaScriptupdated 2025-08-23
A text marking & annotation engine for presenting source code on the web.
★ 927TypeScriptupdated 2026-03-12annotation-toolcode-annotationcode-blockscode-documentationdiff
QGIS is a free, open source, cross platform (lin/win/mac) geographical information system (GIS)
★ 13,667C++updated 2026-04-20
Node Version Manager - POSIX-compliant bash script to manage multiple active node.js versions
★ 93,090Shellupdated 2026-04-04bashinstallltsnodenode-js
A VSCode extension that allows you to use ChatGPT
★ 4,944TypeScriptupdated 2023-09-29
Curated resources about Data Visualization, Drawing & Publishing in R
★ 391Rupdated 2022-07-06
Exploring the new Observable framework on our Blog
★ 4Swiftupdated 2023-09-18
Dedicated SSR (Server-side-rendered) Astro native Headless CMS, built from the ground up for the Astro community and by Astro community members
★ 774TypeScriptupdated 2026-04-20astro-integrationastro-studiocmsastrojscmscontent-management-system
Yet another i18n integration for Astro with server and client utilities, type safety and translations built-in.
★ 63TypeScriptupdated 2025-10-27astroastro-componentastro-integrationi18ni18next
Author themes for Astro like a normal project and export your work as an integration for others to use
★ 43TypeScriptupdated 2025-03-11
The place for content that goes beyond the official docs, for all Astronauts!
★ 121MDXupdated 2026-04-20astro
Crisp, minimal, personal blog theme for Astro
★ 594Astroupdated 2025-11-03astrobuildastrodotbuildblogmarkdocmarkdown
Git-based headless CMS. Successor to Netlify CMS (now Decap CMS). Modern UX, first-class i18n support, mobile support + 100s of improvements. Framework-agnostic, open source & free.
★ 2,332JavaScriptupdated 2026-04-18cmscontent-managementcontent-management-systemdamdark-mode
A collection of composable React components for building interactive data visualizations
★ 11,243TypeScriptupdated 2025-12-19chartsd3data-visualizationreact
⚛️ Simple, immersive & interactive charts for React
★ 3,153HTMLupdated 2025-03-10chartcomponentd3reactreact-motion
📊 Data visualization library for React. Maintained by @goodcodeus.
★ 1,229TypeScriptupdated 2026-04-07area-chartsbar-chartsbubble-chartcharting-librarycharts
A started template with Tailwind and Astro
★ 159Astroupdated 2026-02-11astrostarter-blogtailwind
Fedora Loves Python website
★ 18CSSupdated 2021-05-27fedorapythonwebsite
A curated list of awesome Dash (plotly) resources
★ 2,256Pythonupdated 2024-12-30awesomeawesome-listplotlypython
an example Plotly Dash web dashboard of a simple CMS manager
★ 1Jupyter Notebookupdated 2022-12-08
Bring data to life with SVG, Canvas and HTML. :bar_chart::chart_with_upwards_trend::tada:
★ 112,798Shellupdated 2025-12-02chartchartsd3data-visualizationsvg
A list of D3 libraries, plugins and utilities
★ 5,303updated 2023-01-13chartsd3jsdatavisualizationjavascriptmaps
Data Visualization Components
★ 8,787JavaScriptupdated 2024-12-18chartcharting-librarydata-visualizationreactuber
:chart_with_upwards_trend: A curated list of awesome data visualization libraries and resources.
★ 4,317updated 2024-01-26awesome-listchartdata-visualizationdatavizvisualization
The interactive graphing library for Python :sparkles:
★ 18,480Pythonupdated 2026-04-15d3dashboarddeclarativegraph-libraryinteractive
GUI frontend for espanso
★ 105Rustupdated 2026-02-03
A Privacy-first, Cross-platform Text Expander written in Rust
★ 13,669Rustupdated 2026-04-19espansolinuxmacosproductivityproductivity-tools
Btrfs snapshot management GUI frontend
★ 152Rustupdated 2026-01-23btrfsgtk
A simple wayland native screenshot tool.
★ 215Rustupdated 2024-06-28
Screenshot tool for Linux
★ 74Perlupdated 2023-12-23
Library and examples for creating an RDP server.
★ 181C++updated 2026-04-19
An application for managing BTRFS subvolumes and Snapper snapshots (mirrored from GitLab)
★ 35C++updated 2022-04-09btrfsbtrfs-snapshotssnapper
An opinionated list of Python frameworks, libraries, tools, and resources
★ 294,413Pythonupdated 2026-04-19awesomecollectionspythonpython-frameworkspython-libraries
Official repository for Spyder - The Scientific Python Development Environment
★ 9,204Pythonupdated 2026-04-19anacondaanaconda-distributionidelanguage-server-protocolpyqt5
Stallion - A Python Package Manager
★ 302Pythonupdated 2021-12-09
Control monitor settings using DDC/CI and USB
★ 1,320Cupdated 2026-04-18calibrationddcddc-cimccsmonitor
A static site generator for data apps, dashboards, reports, and more. Observable Framework combines JavaScript on the front-end for interactive graphics with any language on the back-end for data analysis.
★ 3,455TypeScriptupdated 2026-04-09d3dashboardframeworkmarkdownstatic-site-generator
150+ open source icon sets. Icons are validated, cleaned up, optimised, ready to render as SVG. Updated automatically 3 times a week.
★ 974TypeScriptupdated 2026-04-19
Enlightened library to convert HTML and CSS to SVG
★ 13,332TypeScriptupdated 2026-03-20cssimageimage-generationimage-generatorjsx
0xDedinfosec Blogs
★ 45MDXupdated 2024-05-16
🌩️ A list of awesome online development environments
★ 3,488updated 2024-12-03awesomeawesome-listidelistlists
Open Komodo IDE is a fast and free multi-language code editor. Written in JS, Python, C++ and based on the Mozilla platform.
★ 644Pythonupdated 2022-12-15
Awesome of Static Site Generators.
★ 9updated 2023-11-07
Awesome Smithy is a curated list of awesome build-tools, code-generators, examples, and other resources related to the Smithy IDL.
★ 247updated 2026-04-14apiawesomeawesome-listawsclient
Badges for Linux/FLOSS distributions (mirror: https://salsa.debian.org/debian/distrobadges)
★ 13Nimupdated 2021-02-22badgesdebiandistributiondistributionsnim
Awesome Low Code platforms, vendors, tools and resources
★ 435updated 2026-04-05awesomeawesome-listbusiness-process-automationcitizen-developerscitizen-development
:two_men_holding_hands: A curated list of awesome developer tools for writing cross-platform Node.js code
★ 1,200updated 2023-02-07awesomeawesome-list
:sunglasses: Yeoman generator for GitHub awesome lists
★ 374JavaScriptupdated 2026-04-10awesome-listhacktoberfestyeoman-generator
A list of publicly available datasets with real-time data maintained by the team at bytewax.io
★ 2,431updated 2026-04-13awesome-listdatadata-sciencedata-visualizationdatasets
★ 16Pythonupdated 2022-10-28
ReText: Simple but powerful editor for Markdown and reStructuredText
★ 2,026Pythonupdated 2026-04-19editormarkdownmarkdown-editormarkup-languagerestructuredtext
🎨 A curated list of delightful VS Code packages and resources.
★ 28,613JavaScriptupdated 2024-06-21awesomeawesome-listlistvisual-studiovisual-studio-code
Educational resources to learn to program (Foundation in Web Development)
★ 4,764updated 2025-05-10
Curated list of 20,000+ hours and 200+ free courses with certificates in IT, CS, Design and Business.
★ 4,662updated 2026-01-14awesomeawesome-listbadgescareercertificate
A curated list of awesome big data frameworks, ressources and other awesomeness.
★ 14,366updated 2026-02-05awesomeawesome-listbigdatadatadata-analytics
A collection of awesome things regarding React ecosystem
★ 73,039updated 2026-03-27awesomeawesome-listjavascriptreactreact-apps
Tools Online
★ 1,237updated 2026-03-26cdncssfavicontool
A curated list of awesome Vagrant resources, plugins, tutorials and other nice things.
★ 624updated 2020-10-08awesomeawesome-listlistvagrantvagrant-resources
A curated list of data engineering tools for software developers
★ 8,557updated 2026-04-05awesomeawesome-list
A collection of awesome markdown goodies (libraries, services, editors, tools, cheatsheets, etc.)
★ 1,849updated 2026-04-11
A curated list of awesome tools, platforms, products and resources for MSPs
★ 147updated 2025-04-09awesomemanaged-service-provider
Ubuntu Cleaner is a tool that makes it easy to clean your ubuntu system.
★ 255Pythonupdated 2022-03-25
GUI program for installing additional packages
★ 21C++updated 2026-04-17
👌 My collection of go-to web development resources
★ 284updated 2024-05-21
A curated list of awesome developer-first tools products.
★ 1,617updated 2026-04-07awesomeawesome-listdeveloper-firstdeveloper-tools
Eclipse Theia is a cloud & desktop IDE framework implemented in TypeScript.
★ 21,481TypeScriptupdated 2026-04-20cloud-ideeditorelectronidelanguage-server-protocol
AndroidIDE is an IDE for Android to develop full featured Android apps.
★ 2,886Javaupdated 2024-10-18androidandroid-ideandroidideautocompletecollaborate
Universal icon framework. One syntax for FontAwesome, Material Design Icons, DashIcons, Feather Icons, EmojiOne, Noto Emoji and many other open source icon sets (over 150 icon sets and 200k icons). SVG framework, React, Vue and Svelte components!
★ 6,067TypeScriptupdated 2026-04-20emojiglyph-fontsiconssvgsvg-framework
Inline and sprite-based SVGs in Astro made easy!
★ 1,396MDXupdated 2025-03-31astroiconsvg
Generates rich GDPR-conform link previews / embeds in your astro project
★ 5Astroupdated 2024-04-24astromicrolinkoembed
Curated resources on building sites with Astro, a brand new way to build static and server rendered sites, with cross-framework components, styling and reactive store support.
★ 885updated 2026-01-21astrodotbuildawesomeawesome-listserver-side-renderingstatic-site
Low-JavaScript embed components for Astro websites
★ 387Astroupdated 2026-04-19astrooembedtwittervimeoyoutube
This Astro integration generates preview images for external links.
★ 44TypeScriptupdated 2025-11-14astroastro-integrationexternal-linksimagelinks
The official place to discuss all things VS Code!
★ 254updated 2024-01-27
:open_file_folder: :page_with_curl: A list of strictly flat-file cms systems
★ 717updated 2025-05-12
Quickly launch an 11ty-generated static site. Includes a minimal Sass framework, generated sitemap, and RSS feed.
★ 241SCSSupdated 2024-01-1711ty11ty-templateeleventyeleventy-samplejamstack
Tiny Rocket theme / template for Astro
★ 26Astroupdated 2025-11-18
A theme for Astro
★ 277Astroupdated 2025-02-03astroastrobuildblogjamstacknetlify
Ovidius - a single-author blog theme for Astro.js.
★ 114Astroupdated 2025-11-04astroastro-templateastro-themeastrojsblog
Magically generate Markdown badges for your docs 🛡️ 🦡 🧙
★ 478TypeScriptupdated 2026-04-16badgebadge-generatorboilerplatedocs-generatordocumentation-generator
A curated collection of awesome things related to status badges
★ 929Markdownupdated 2026-03-11awesome-listbadges
Badges for your personal developer branding, profile, and projects.
★ 16,488SCSSupdated 2026-03-26badges-markdownbrandingdeveloper-portfoliogithub-profilegithub-profile-readme
Concise, consistent, and legible badges in SVG and raster format
★ 26,501JavaScriptupdated 2026-04-18badgebadge-makergithubhacktoberfestmetadata
A minimal, accessible and SEO-friendly Astro blog theme
★ 4,546Astroupdated 2026-03-26a11yaccessibilityastroastro-themeastro-themes
A list of awesome hexo themes.
★ 34updated 2020-12-19hexohexo-bloghexo-theme
A curated list of awesome things related to Hexo
★ 664updated 2025-09-02awesome-listhexohexo-pluginhexo-themehexo-tutorial
A fast, simple & powerful blog framework, powered by Node.js.
★ 41,359TypeScriptupdated 2026-04-15hacktoberfesthexojavascriptnodejsstatic-site-generator
An elegant static blog generator
★ 1,088Goupdated 2025-06-26blog-enginegolangjavascriptstatic-site-generator
A static site generator for Swift developers
★ 4,965Swiftupdated 2024-07-09publishstatic-site-generatorswiftweb-development
Open-source developer content platform
★ 1,979TypeScriptupdated 2025-10-28bloggingcmscollaborationcontent-managementdocumentation
The core Laravel CMS Composer package
★ 4,795PHPupdated 2026-04-20api-restcmscomposer-packagecontent-management-systemflat-file-cms
A list of all relevant TinaCMS plugins, extensions, and more.
★ 106updated 2025-04-26awesome-listtinatina-cmstinacms
The web framework for content-driven websites. ⭐️ Star to support our work!
★ 58,774TypeScriptupdated 2026-04-20astroblogbrowsercomponentshybrid
A theme for hugo made using tailwind CSS library and mono font family
★ 36CSSupdated 2024-06-11blogdarkdark-modedark-themehugo
A simple links theme for Hugo built with Tailwind CSS.
★ 466CSSupdated 2026-01-06dark-modeemojihugohugo-themelinks
A curated list of awesome things related to Hugo, The world's fastest framework for building websites.
★ 1,073HTMLupdated 2025-06-18awesomeawesome-listgohugostatic-site-generator
Anatole is a minimalistic two-column theme for Hugo.
★ 733HTMLupdated 2026-03-04anatolefarboxhacktoberfesthugominimalistic-theme
If you live in the terminal, kitty is made for you! Cross-platform, fast, feature-rich, GPU based.
★ 32,595Pythonupdated 2026-04-20cgogolanggolang-applicationkitty
DECK is a powerful and high performant local web development studio, an open source alternative to Docker desktop
★ 1,494Svelteupdated 2024-06-11containersdeckdockerdocker-composeflights
Laravel GUI, To simply run artisan, composer and NPM commands and other helpful actions and get output in one click!
★ 36updated 2019-07-15
Helm Chart for Zigbee2MQTT
★ 36Mustacheupdated 2026-04-13
Faust.js™ - The Headless WordPress Toolkit
★ 1,571TypeScriptupdated 2026-04-20composable-architecturehacktoberfestheadlessheadless-cmsheadless-wordpress
A process for automating Docker container base image updates.
★ 24,588Goupdated 2025-12-17automationcontinuous-deliverydevopsdockerhacktoberfest
Business intelligence as code: build fast, interactive data visualizations in SQL and markdown
★ 6,205JavaScriptupdated 2026-02-18analyticsbusiness-intelligencedashboarddata-engineeringdata-science
:cloud: A curated list of awesome services, solutions and resources for serverless / nobackend applications.
★ 7,585updated 2026-02-11cloudcloud-computingmicroservicenobackendserverless-applications
A curated list of awesome self-hosted alternatives to Amazon Web Services (AWS)
★ 630updated 2024-08-28
A curated list of awesome documentation tools
★ 856updated 2026-04-13awesomeawesome-listdocs
A free and open source local CMS for static site generators
★ 121Dartupdated 2024-02-2411tyblogcmscontent-management-systemgui
💖 A curated list of awesome things related to docsify
★ 2,607updated 2026-04-09awesomeawesome-listdocsifydocsify-plugin
A curated list of static web site generators.
★ 3,691updated 2026-04-02awesome-listwebsite
★ 88TypeScriptupdated 2020-12-10
Super simple user dashboards for Supabase users.
★ 682Vueupdated 2022-07-28dashboardfrontendsupabasewebdev
A list of SaaS, PaaS and IaaS offerings that have free tiers of interest to devops and infradev
★ 120,907HTMLupdated 2026-04-17awesome-listfree-for-developers
Free and open source no-code application builder
★ 2,006JavaScriptupdated 2026-04-20no-codenocode
Apache Spark - A unified analytics engine for large-scale data processing
★ 43,194Scalaupdated 2026-04-20big-datajavajdbcpythonr
An open source implementation of OpenAI's ChatGPT Code interpreter
★ 3,557Pythonupdated 2024-03-20chatgptgptllmsopenai
A curated list of modern Generative Artificial Intelligence projects and services
★ 11,907updated 2026-04-18aiartificial-intelligenceawesomeawesome-listgenerative-ai
A remote monitoring & management tool, built with Django, Vue and Go.
★ 4,271Pythonupdated 2026-04-09djangodjango-rest-frameworkmonitoringpythonremote-admin-tool
continuous integration and continuous delivery
★ 1,993updated 2026-04-14
Simple Linux Mobile Device Management
★ 94Pythonupdated 2024-10-15
Source code for Uyuni
★ 554Javaupdated 2026-04-20containercucumberhacktoberfesthacktoberfest-acceptedjava
🕶 Awesome list of automation software (local, or ☁️)
★ 74updated 2024-01-08automationcloudlistsoftware
A curated list of amazingly awesome WordPress resources, themes, plugins and shiny things. Inspired by awesome-php.
★ 1,486HTMLupdated 2024-07-04
BackBlaze B2 cross-platform client to manage your buckets easily
★ 1JavaScriptupdated 2021-05-22backblaze-b2cross-platform
A curated list of awesome things related to Strapi
★ 1,512JavaScriptupdated 2024-06-30awesome-liststrapi
A list of web hosts that work well with Statamic right out of the box.
★ 37updated 2026-03-23
A curated list of Integrated Development Environments (IDEs) and related tools that can enhance your coding experience and boost your productivity.
★ 182Markdownupdated 2025-12-22awesomeawesome-listcode-editorscoding-environmentcollaboration
Tailwind scaffolding for the Laravel framework.
★ 4,057PHPupdated 2026-03-24authlaraveltailwind
A fork of Laravel Valet to work in Linux.
★ 1,463PHPupdated 2025-07-04arch-linuxfedoralaravellinuxubuntu
★ 75updated 2022-04-28
Get help with your Wagtail content using AI superpowers.
★ 193Pythonupdated 2026-03-04aidjangohacktoberfestwagtail
Carefully curated list of awesome Jamstack resources
★ 1,362updated 2025-06-24awesomeawesome-listjamstackjavascriptstatic-site
Israel municipalities' geojson polygones
★ 10updated 2016-07-06
Distributed PostgreSQL as an extension
★ 12,445Cupdated 2026-04-20cituscitus-extensiondatabasedatabase-clusterdistributed-database
"Monitorr” is a self-hosted PHP web app that monitors the status of local and remote network services, websites, and applications.
★ 676PHPupdated 2023-05-25curldockerhtmlhtpcjavascript
🚀 A self-hostable personal dashboard built for you. Includes status-checking, widgets, themes, icon packs, a UI editor and tons more!
★ 24,821Vueupdated 2026-04-20awesomedashboarddockerhomelabhomepage
A highly customizable homepage (or startpage / application dashboard) with Docker and service API integrations.
★ 29,748JavaScriptupdated 2026-04-20dockerhomepagenextjsnodereact
Free and Open source Web Builder Framework. Next generation tool for building templates without coding
★ 25,744TypeScriptupdated 2026-04-10drag-and-dropframeworkno-codenocodepage-builder
The open-source visual builder framework.
★ 542TypeScriptupdated 2024-08-15drag-and-dropno-codeno-code-frameworkreactvisual-builder
Modern, Crazy Fast, Ridiculously Easy and Amazingly Powerful Flat-File CMS powered by PHP, Markdown, Twig, and Symfony
★ 15,465PHPupdated 2026-04-16cmscontentcontent-managementdoctrineflat-file
The most intuitive Static Site CMS designed for SEO-optimized and privacy-focused websites.
★ 7,165HTMLupdated 2026-04-19cmselectronelectronjsfedorahandlebars
TinyMDE: A tiny, dependency-free embeddable HTML/JavaScript Markdown editor.
★ 201TypeScriptupdated 2026-04-10
A Git-based CMS for Static Site Generators
★ 19,012JavaScriptupdated 2026-04-20cmscontent-management-systemdecap-cmsgit-based-cmsheadless-cms
An awesome list of headless / decoupled CMS resources.
★ 238updated 2026-04-06awesomeawesome-listcmsheadlessheadless-cms
Payload is the open-source, fullstack Next.js framework, giving you instant backend superpowers. Get a full TypeScript backend and admin panel instantly. Use Payload as a headless CMS or for building powerful applications.
★ 42,034TypeScriptupdated 2026-04-20cmscontent-managementcontent-management-systemexpressgraphql
Docker files for running a basic Laravel application.
★ 1,893Shellupdated 2026-04-14dockerlaravel
Scotch Box is a preconfigured Vagrant Box with a full array of LAMP Stack features to get you up and running with Vagrant in no time.
★ 2,674PHPupdated 2018-05-25
A Django content management system focused on flexibility and user experience
★ 20,305Pythonupdated 2026-04-20cmsdjangohacktoberfestpythonwagtail
Data management service that brings continuous data validation to tabular data in your repository via Github Action
★ 43JavaScriptupdated 2024-06-30
List of publicly available, free/open source and open access resources for learning and doing data journalism.
★ 64updated 2024-03-03awesomeawesome-listdatadata-analysisdata-journalism
Deploy wagtail with docker-compose
★ 5Dockerfileupdated 2021-06-17docker-composedocker-compose-filesdocker-compose-templatedockerfilewagtail
Component-based CMS with a built-in IDE, visual editing, and static site generation. One server, unlimited sites.
★ 2,326Svelteupdated 2026-04-20cmscomponent-librarycsshtmlide
dbt + Metabase integration
★ 595Pythonupdated 2026-04-19analyticsbusiness-intelligencedatadata-modellingdbt
📚 A collection of open and closed source Content Management Systems (CMS) for your perusal.
★ 3,117updated 2026-03-27awesome-listcmslabstoml
Awesome list of Headless CMS solutions. Hosted and self-hosted. Open source as well.
★ 60updated 2024-12-19cloud-cmscmsdecoupledheadlessmongodb
CaddyProxyManager - Manage Caddy via a web interface
★ 205Goupdated 2022-10-04caddycaddyserverreverse-proxywebinterface
A file server that supports static serving, uploading, searching, accessing control, webdav...
★ 9,998Rustupdated 2026-03-04cloud-diskcommand-linefile-sharingfile-upload-serverrust
A self hosted CDN solution written in Go
★ 39Goupdated 2026-04-06cdn
Reliable PostgreSQL Backup & Restore
★ 3,743Cupdated 2026-04-14archivingazurebackupbzip2checksum
Data workflow tool, like a "Make for data"
★ 1,486Clojureupdated 2022-04-12
A curated list of awesome nocode / lowcode applications to build other applications
★ 1,186updated 2026-04-17
🕶️A curated list of awesome tools for dealing with CSV.
★ 922PowerShellupdated 2026-04-04awesomeawesome-listcsvcsv-convertercsv-data
Source website for openrefine.org
★ 157TypeScriptupdated 2026-04-16
Concrete CMS Composer base.
★ 36PHPupdated 2024-09-10
A curated list of awesome PostgreSQL tools, scripts, slides, and short examples. inspired by the other awesome lists
★ 83updated 2025-11-05
A curated list of awesome PostgreSQL software, libraries, tools and resources, inspired by awesome-mysql
★ 11,865updated 2026-03-28databasepostgrespostgresql
Platform to build admin panels, internal tools, and dashboards. Integrates with 25+ databases and any API.
★ 39,687TypeScriptupdated 2026-04-18admin-dashboardadmin-panelsapp-builderautomationcrud
Create agents that monitor and act on your behalf. Your agents are standing by!
★ 49,184Rubyupdated 2026-04-19agentautomationfeedfeedgeneratorhuginn
🚀 Strapi is the leading open-source headless CMS. It’s 100% JavaScript/TypeScript, fully customizable, and developer-first.
★ 72,003TypeScriptupdated 2026-04-20apicmscms-frameworkcontent-managementcontent-management-system
The toolkit to pack, ship, store, and deliver container content
★ 10,377Goupdated 2026-04-20cncfcontainersdistributionocioci-specification
★ 226Dockerfileupdated 2025-01-29
Enable Self-Service Operations: Give specific users access to your existing tools, services, and scripts
★ 6,106Groovyupdated 2026-04-17ansibleauditautomationcategory-distributeddeployment
An Ansible AWX operator for Kubernetes built with Operator SDK and Ansible. 🤖
★ 1,473Jinjaupdated 2026-04-14awxawx-operatorhacktoberfestkuberneteskubernetes-operator
AWX provides a web-based user interface, REST API, and task engine built on top of Ansible. It is one of the upstream projects for Red Hat Ansible Automation Platform.
★ 15,386Pythonupdated 2026-04-15ansibleautomationawxdjangodjango-rest-framework
Self-Hosting Guide. Learn all about locally hosting (on premises & private web servers) and managing software applications by yourself or your organization. Including Cloud, LLMs, WireGuard, Automation, Home Assistant, and Networking.
★ 19,525Dockerfileupdated 2025-06-27authenticationawesomeawesome-listdecentralizeddocker-compose
Exoframe is a self-hosted tool that allows simple one-command deployments using Docker
★ 1,150JavaScriptupdated 2026-02-22cli-appdeploy-tooldeploymentdevopsdocker
An Operator that installs Gitea
★ 26Goupdated 2022-04-21
Automation engine to build, test and ship any codebase. Runs locally, in CI, or directly in the cloud
★ 15,713Goupdated 2026-04-20agentscachingci-cdcontainerscontinuous-deployment
Concourse is a container-based automation system written in Go. It's mostly used for CI/CD.
★ 7,823Goupdated 2026-04-20cici-cdconcoursecontainerdcontainers
The list of continuous integration services and tools
★ 4,079updated 2026-03-01awesomecicomparisoncontinuous-integrationdeveloper-tools
A simple GUI front-end for OpenSSH for Windows, Linux and Mac!
★ 39C#updated 2026-04-10
Backup All - A Terminus plugin to backup all available Pantheon sites with one command.
★ 2PHPupdated 2019-02-23backupcomposerpantheonpluginterminus
A blog starter kit to use Hashnode as a Headless CMS using GraphQL APIs.
★ 645TypeScriptupdated 2025-01-13graphqlheadless-cmsnextjstailwindcss
Metabase Interactive Embedding Sample for Node.js
★ 5JavaScriptupdated 2026-02-26
An intuitive spreadsheet-like interface that lets users of all technical skill levels view, edit, query, and collaborate on Postgres data directly—100% open source and self hosted, with native Postgres access control.
★ 4,933Svelteupdated 2026-04-19airtable-alternativeautomatic-apidatabase-accessdatabase-guidatabase-management
🔥 🔥 🔥 A Free & Self-hostable Airtable Alternative
★ 62,847TypeScriptupdated 2026-04-20airtableairtable-alternativeautomatic-apihacktoberfestlow-code
Self-hosted pastebin powered by Git, open-source alternative to Github Gist.
★ 3,101Goupdated 2026-04-13dockergistgitgogolang
Portainer PWA Wrapped with electron.js
★ 7JavaScriptupdated 2021-11-22dockerelectronportainerportainer-desktoppwa
dyrector.io is a self-hosted continuous delivery & deployment platform with version management.
★ 1,835TypeScriptupdated 2026-04-15containersdeliverydeveloperdockergolang
The Google Compute Engine Persistent Disk (GCE PD) Container Storage Interface (CSI) Storage Plugin.
★ 182Goupdated 2026-04-20gcpk8s-sig-gcp
A simple ClickHouse client.
★ 343JavaScriptupdated 2022-11-10
A React Framework for building internal tools, admin panels, dashboards & B2B apps with unmatched flexibility.
★ 34,557TypeScriptupdated 2026-04-15adminadmin-uiant-designcruddeveloper-tools
🦉 Data Versioning and ML Experiments
★ 15,565Pythonupdated 2026-04-14aidata-sciencedata-version-controldeveloper-toolsmachine-learning
Dolt – Git for Data
★ 22,346Goupdated 2026-04-19agent-memoryagent-memory-serverai-agentsai-databasedata-version-control
ClickHouse database driver for the Metabase business intelligence front-end
★ 512Clojureupdated 2025-06-13analyticsbi-toolsbusiness-intelligenceclickhousemetabase
A curated list of awesome ETL frameworks, libraries, and software.
★ 3,551updated 2026-03-07awesomeawesome-listetl
Focus on what matters instead of fighting with Git.
★ 21,411TypeScriptupdated 2026-04-17electrongitgithubgithub-desktoptypescript
Python driver/sqlalchemy/superset connectors
★ 483Pythonupdated 2026-04-17clickhousepython
Metabase DuckDB Driver shipped as 3rd party plugin
★ 81Clojureupdated 2024-04-11
A curated list of awesome pipeline toolkits inspired by Awesome Sysadmin
★ 6,571updated 2026-04-17awesome-listworkflow
Metabase deployment in Google Kuberenetes Engine
★ 25Shellupdated 2018-09-26gcpgkekubernetesmetabase
My helm charts
★ 111Go Templateupdated 2026-04-13
Helm chart to deploy Metabase on GKE
★ 7Mustacheupdated 2021-02-28
CLI for Crunchy Bridge
★ 28Crystalupdated 2025-10-31
An Awesome List of Open-Source Data Engineering Projects
★ 3,161updated 2024-10-04awesome-listdata-engineering
Everything that makes working with databases easier
★ 5,089updated 2026-04-15awesomeawesome-listcross-databasedatabasedatabase-management
A collective list of free APIs
★ 426,528Pythonupdated 2026-03-18apiapisdatasetdevelopmentfree
Apache Druid: a high performance real-time analytics database.
★ 13,982Javaupdated 2026-04-18druid
Meltano: the declarative code-first data integration engine that powers your wildest data and ML-powered product ideas. Say goodbye to writing, maintaining, and scaling your own API integrations.
★ 2,469Pythonupdated 2026-04-17connectorsdatadata-engineeringdata-pipelinesdataops
Open Integration Hub
★ 196JavaScriptupdated 2025-08-20data-synchronizationframeworkintegrationintegration-flowjavascript
Awesome list for datapipeline
★ 35updated 2023-02-06architectureawesomeawesome-listbig-databigdata
The missing UI for Helm - visualize your releases
★ 5,687TypeScriptupdated 2026-04-16guihelmhelm-pluginhelm-pluginsk8s
Optimized and Maintenance-free Kubernetes on Hetzner Cloud in one command! With Pulumi!
★ 20Goupdated 2024-11-12
An elegant home server OS. Run OpenClaw, store your files and photos, run a Bitcoin node, and do more with over 300 apps in the Umbrel App Store.
★ 11,056TypeScriptupdated 2026-02-11bitcoindockerhome-serverhomeserverlightning
A ChatGPT bot for Kubernetes issues.
★ 918Pythonupdated 2024-11-21chatbotchatgptkubernetesprometheusslack
Marketplace of Kubernetes applications available for quick and easy installation in to Civo Kubernetes clusters
★ 247Shellupdated 2026-04-18civoclusterdatabasek3sk8s
Deploying Apache Superset with Dokku
★ 1Pythonupdated 2023-10-16apache-supersetdokku
KubeCube is an open source enterprise-level container platform
★ 524Goupdated 2024-01-31arm-supportcertified-kubernetescloud-nativekubernetesmulti-clusters
Run metabase on Dokku (A self hosted Heroku clone)
★ 8updated 2017-09-07
Metadata and tooling for the OpenTofu registry
★ 403Goupdated 2026-04-20
Giving Kubernetes Superpowers to everyone
★ 7,710Goupdated 2026-04-20aidevopskubernetesllamaopenai
Docker compose compatible client to deploy to Rancher
★ 213Goupdated 2019-06-17
Define and run multi-container applications with Docker
★ 37,315Goupdated 2026-04-20dockerdocker-composegogolangorchestration
🪓 Run Background Tasks at Scale
★ 6,985Goupdated 2026-04-20concurrencydagdistributeddistributed-systemsdurable-execution
Unagex Kubernetes Operator for Metabase
★ 18Goupdated 2024-02-15kuberneteskubernetes-operatormetabasemetabase-operator
★ 138Smartyupdated 2024-09-25cloudflarehelmhelm-chartskubernetes
Automatically create and manage certificates in Rancher using Let's Encrypt webroot verification via a minimal service
★ 92Pythonupdated 2023-05-22certletsencryptpythonrancherrancher-api
Automatically provision and manage TLS certificates in Kubernetes
★ 13,772Goupdated 2026-04-20certificatecrdhacktoberfestkubernetesletsencrypt
Rancher UI driver for the Hetzner Cloud docker driver.
★ 264JavaScriptupdated 2024-04-07dockerhcloudhetznerhetzner-cloudrancher
Self-hosted lightweight PaaS solution to deploy and manage your applications on any VPS [Your own self-hosted Heroku, Vercel]
★ 802Goupdated 2025-11-20dockerlightweightpaasself-hostedswarm-mode
The Airgap Native Package Manager for Kubernetes
★ 1,877Goupdated 2026-04-20airgapcloud-nativecosigndockerdocker-registry
Stratos: Web-based Management UI for Cloud Foundry and Kubernetes
★ 263TypeScriptupdated 2026-04-20angularcf-extensionscloudcloud-foundryconsole
The leading data integration platform for ETL / ELT data pipelines from APIs, databases & files to data warehouses, data lakes & data lakehouses. Both self-hosted and Cloud-hosted.
★ 21,137Pythonupdated 2026-04-20bigquerychange-data-capturedatadata-analysisdata-collection
A docker compose file to deploy a production ready Metabase instance
★ 57updated 2026-02-20
★ 7Dockerfileupdated 2025-02-08
Bitnami Helm Charts
★ 10,337Go Templateupdated 2026-04-20bitnamichartshelmhelm-chartskubernetes
★ 4JavaScriptupdated 2023-01-23
A toolkit to run Ray applications on Kubernetes
★ 2,468Goupdated 2026-04-19apachedeep-learningkubernetesmachine-learningray
Lightweight Durable TypeScript Workflows
★ 1,161TypeScriptupdated 2026-04-16agentic-workflowcronjob-schedulerdbosdurable-executiondurable-workflows
Transactional functions-as-a-service for database-oriented applications.
★ 157Javaupdated 2023-10-13
Find, install and publish Cloud Native packages
★ 2,025TypeScriptupdated 2026-04-16cloud-nativecncfkubernetespackages
Companion repo for the HashiCorp Nomad Get Started collection of tutorials
★ 19HCLupdated 2024-08-12
A docker-powered PaaS that helps you build and manage the lifecycle of applications
★ 31,860Shellupdated 2026-04-19buildpackcontainersdevopsdockerdokku
Nomad is an easy-to-use, flexible, and performant workload orchestrator that can deploy a mix of microservice, batch, containerized, and non-containerized applications. Nomad is easy to operate and scale and has native Consul and Vault integrations.
★ 16,448Goupdated 2026-04-20
AWS Copilot CLI will reach end-of-support on June 12, 2026.
★ 3,739Goupdated 2026-03-06aws-apprunneraws-ecsaws-fargateaws-fargate-applicationcd-pipelines
A curated list of PaaS, developer platforms, Self hosted PaaS, Cloud IDEs and ADNs.
★ 602updated 2026-03-21
dbt enables data analysts and engineers to transform their data using the same practices that software engineers use to build applications.
★ 12,689Pythonupdated 2026-04-20analyticsbusiness-intelligencedata-modelingdbt-viewpointelt
Open-source data modeling tool designed for PostgreSQL. No more typing DDL commands. Let pgModeler do the work for you!
★ 3,537C++updated 2026-04-18c-plus-pluscode-generatordatabasedatabase-modelingddl-commands