LLMs & Generative AI

1,269 repos
AutoGPT is the vision of accessible AI for everyone, to use and to build on. Our mission is to provide the tools, so that you can focus on what matters.
★ 183,763Pythonupdated 2026-04-20agentic-aiagentsaiartificial-intelligenceautonomous-agents
The agent harness performance optimization system. Skills, instincts, memory, security, and research-first development for Claude Code, Codex, Opencode, Cursor and beyond.
★ 167,109JavaScriptupdated 2026-04-19ai-agentsanthropicclaudeclaude-codedeveloper-tools
f.k.a. Awesome ChatGPT Prompts. Share, discover, and collect prompts from the community. Free and open source — self-host for your organization with complete privacy.
★ 160,697HTMLupdated 2026-04-20aiartificial-intelligenceawesome-listchatgptchatgpt-prompts
🤗 Transformers: the model-definition framework for state-of-the-art machine learning models in text, vision, audio, and multimodal models, for both inference and training.
★ 159,926Pythonupdated 2026-04-20audiodeep-learningdeepseekgemmaglm
Langflow is a powerful tool for building and deploying AI-powered agents and workflows.
★ 147,367Pythonupdated 2026-04-20agentschatgptgenerative-ailarge-language-modelsmultiagent
Production-ready platform for agentic workflow development.
★ 139,176TypeScriptupdated 2026-04-20agentagentic-aiagentic-frameworkagentic-workflowai
The agent engineering platform
★ 134,936Pythonupdated 2026-04-19agentsaiai-agentsanthropicchatgpt
User-friendly AI Interface (Supports Ollama, OpenAI API, ...)
★ 134,144Pythonupdated 2026-04-20aillmllm-uillm-webuillms
Python tool for converting files and office documents to Markdown.
★ 117,108Pythonupdated 2026-04-15autogenautogen-extensionlangchainmarkdownmicrosoft-office
The agent that grows with you
★ 117,089Pythonupdated 2026-04-20aiai-agentai-agentsanthropicchatgpt
🔥 The API to search, scrape, and interact with the web for AI
★ 112,275TypeScriptupdated 2026-04-20aiai-agentsai-crawlerai-scrapingai-search
21 Lessons, Get Started Building with Generative AI
★ 109,836Jupyter Notebookupdated 2026-04-16aiazurechatgptdall-egenerative-ai
100+ AI Agent & RAG apps you can actually run — clone, customize, ship.
★ 107,537Pythonupdated 2026-04-19agentsllmspythonrag
LLM inference in C/C++
★ 106,623C++updated 2026-04-20ggml
★ 102,899Pythonupdated 2025-08-28
An open-source AI agent that brings the power of Gemini directly into your terminal.
★ 102,414TypeScriptupdated 2026-04-20aiai-agentscligeminigemini-api
Robust Speech Recognition via Large-Scale Weak Supervision
★ 98,410Pythonupdated 2026-04-15
Implement a ChatGPT-like LLM in PyTorch from scratch, step by step
★ 91,441Jupyter Notebookupdated 2026-04-16aiartificial-intelligencechatbotchatgptdeep-learning
🌐 Make websites accessible for AI agents. Automate tasks online with ease.
★ 90,325Pythonupdated 2026-04-19ai-agentsai-toolsbrowser-automationbrowser-usellm
✨ Light and Fast AI Assistant. Support: Web | iOS | MacOS | Android | Linux | Windows
★ 87,804TypeScriptupdated 2025-12-02calclaudechatgptclaudecross-platformdesktop
RAGFlow is a leading open-source Retrieval-Augmented Generation (RAG) engine that fuses cutting-edge RAG with Agent capabilities to create a superior context layer for LLMs
★ 79,009Pythonupdated 2026-04-20llm-app
A high-throughput and memory-efficient inference and serving engine for LLMs
★ 78,154Pythonupdated 2026-04-20amdblackwellcudadeepseekdeepseek-v3
Lightweight coding agent that runs in your terminal
★ 77,924Rustupdated 2026-04-20
GPT4All: Run Local LLMs on Any Device. Open-source and available for commercial use.
★ 77,372C++updated 2025-05-27ai-chatllm-inference
The ultimate space for work and life — to find, build, and collaborate with agent teammates that grow with you. We are taking agent harness to the next level — enabling multi-agent collaboration, effortless agent team design, and introducing agents as the unit of work interaction.
★ 75,654TypeScriptupdated 2026-04-20agentagent-collaborationagent-harnessaichatgpt
🐙 Guides, papers, lessons, notebooks and resources for prompt engineering, context engineering, RAG, and AI Agents.
★ 73,813MDXupdated 2026-03-11agentagentsai-agentschatgptdeep-learning
🙌 OpenHands: AI-Driven Development
★ 72,090Pythonupdated 2026-04-20agentartificial-intelligencechatgptclaude-aicli
Unified Efficient Fine-Tuning of 100+ LLMs & VLMs (ACL 2024)
★ 70,611Pythonupdated 2026-04-20agentaideepseekfine-tuninggemma
🌟 The Multi-Agent Framework: First AI Software Company, Towards Natural Language Programming
★ 67,426Pythonupdated 2026-01-21agentgptllmmetagptmulti-agent
🚀🤖 Crawl4AI: Open-source LLM Friendly Web Crawler & Scraper. Don't be shy, join here: https://discord.gg/jP8KfhDhyN
★ 64,592Pythonupdated 2026-04-20
An open-source long-horizon SuperAgent harness that researches, codes, and creates. With the help of sandboxes, memories, tools, skill, subagents and message gateway, it handles different levels of tasks that could take minutes to hours.
★ 63,806Pythonupdated 2026-04-20agentagenticagentic-frameworkagentic-workflowai
A natural language interface for computers
★ 63,313Pythonupdated 2026-04-14chatgptgpt-4interpreterjavascriptnodejs
Web UI for training and running open models like Gemma 4, Qwen3.5, DeepSeek, gpt-oss locally.
★ 62,969Pythonupdated 2026-04-20agentdeepseekfine-tuninggemmagemma3
12 Lessons to Get Started Building AI Agents
★ 59,438Jupyter Notebookupdated 2026-04-20agentic-aiagentic-frameworkagentic-ragai-agentsai-agents-framework
Inference code for Llama models
★ 59,367Pythonupdated 2025-01-26
The all-in-one AI productivity accelerator. On device and privacy first with no annoying setup or configuration.
★ 58,999JavaScriptupdated 2026-04-17ai-agentscustom-ai-agentsdeepseekkimillama3
A programming framework for agentic AI
★ 57,438Pythonupdated 2026-04-15agenticagentic-agiagentsaiautogen
A Simple and Universal Swarm Intelligence Engine, Predicting Anything. 简洁通用的群体智能引擎,预测万物
★ 57,398Pythonupdated 2026-04-02agent-memoryfinancial-forecastingfuture-predictionknowledge-graphllms
1 min voice data can also be used to train a good TTS model! (few shot voice cloning)
★ 56,969Pythonupdated 2026-04-19text-to-speechttsvitsvoice-clonevoice-cloneai
⭐AI-driven public opinion & trend monitor with multi-platform aggregation, RSS, and smart alerts.🎯 告别信息过载,你的 AI 舆情监控助手与热点筛选工具!聚合多平台热点 + RSS 订阅,支持关键词精准筛选。AI 智能筛选新闻 + AI 翻译 + AI 分析简报直推手机,也支持接入 MCP 架构,赋能 AI 自然语言对话分析、情感洞察与趋势预测等。支持 Docker ,数据本地/云端自持。集成微信/飞书/钉钉/Telegram/邮件/ntfy/bark/slack 等渠道智能推送。
★ 55,242Pythonupdated 2026-04-18aibarkdata-analysisdockerhot-news
CLI platform to experiment with codegen. Precursor to: https://lovable.dev
★ 55,220Pythonupdated 2025-05-14aiautonomous-agentcode-generationcodebase-generationcodegen
🔮 ChatGPT Desktop Application (Mac, Windows and Linux)
★ 54,372Rustupdated 2024-08-29aiappapplicationchatgptdesktop-app
omo; the best agent harness - previously oh-my-opencode
★ 54,169TypeScriptupdated 2026-04-20aiai-agentsampanthropicchatgpt
Universal memory layer for AI Agents
★ 54,076Pythonupdated 2026-04-20agentsaiai-agentsapplicationchatbots
Context7 Platform -- Up-to-date code documentation for LLMs and AI code editors
★ 53,733TypeScriptupdated 2026-04-18llmmcpmcp-servervibe-coding
TradingAgents: Multi-Agents LLM Financial Trading Framework
★ 53,055Pythonupdated 2026-04-13agentfinancellmmultiagenttrading
The best ChatGPT that $100 can buy.
★ 52,514Pythonupdated 2026-04-14
A cross-platform desktop All-in-One assistant tool for Claude Code, Codex, OpenCode, openclaw & Gemini CLI.
★ 51,481Rustupdated 2026-04-20ai-toolsclaude-codecodexdesktop-appmcp
Framework for orchestrating role-playing, autonomous AI agents. By fostering collaborative intelligence, CrewAI empowers agents to work together seamlessly, tackling complex tasks.
★ 49,930Pythonupdated 2026-04-20agentsaiai-agentsaiagentframeworkllms
The best-benchmarked open-source AI memory system. And it's free.
★ 49,688Pythonupdated 2026-04-19aichromadbllmmcpmemory
Port of OpenAI's Whisper model in C/C++
★ 49,040C++updated 2026-04-20inferenceopenaispeech-recognitionspeech-to-texttransformer
LlamaIndex is the leading document agent and OCR platform
★ 48,939Pythonupdated 2026-04-16agentsapplicationdatafine-tuningframework
The original local LLM interface. Text, vision, tool-calling, training. UI + API, 100% offline and private.
★ 46,861Pythonupdated 2026-04-20
LocalAI is the open-source AI engine. Run any model - LLMs, vision, voice, image, video - on any hardware. No GPU required.
★ 45,835Goupdated 2026-04-20agentsaiapiaudio-generationdecentralized
Python SDK, Proxy Server (AI Gateway) to call 100+ LLM APIs in OpenAI (or native) format, with cost tracking, guardrails, loadbalancing and logging. [Bedrock, Azure, OpenAI, VertexAI, Cohere, Anthropic, Sagemaker, HuggingFace, VLLM, NVIDIA NIM]
★ 44,731Pythonupdated 2026-04-20ai-gatewayanthropicazure-openaibedrockgateway
AI productivity studio with smart chat, autonomous agents, and 300+ assistants. Unified access to frontier LLMs
★ 44,405TypeScriptupdated 2026-04-20agency-agentsai-agentclaude-codecodexopen-cli
Milvus is a high-performance, cloud-native vector database built for scalable vector ANN search
★ 43,986Goupdated 2026-04-20annscloud-nativediskanndistributedembedding-database
aider is AI pair programming in your terminal
★ 43,948Pythonupdated 2026-04-09anthropicchatgptclaude-3clicommand-line
an open source, extensible AI agent that goes beyond code suggestions - install, execute, edit, and test with any LLM
★ 43,281Rustupdated 2026-04-20acpaiai-agentsmcp
🦍 The API and AI Gateway
★ 43,260Luaupdated 2026-03-27aiai-gatewayapi-gatewayapi-managementapis
A privacy-first, self-hosted, fully open source personal knowledge management software, written in typescript and golang.
★ 42,990TypeScriptupdated 2026-04-20ankichatgptdeepseekelectronevernote
Ray is an AI compute engine. Ray consists of a core distributed runtime and a set of AI Libraries for accelerating ML workloads.
★ 42,311Pythonupdated 2026-04-20data-sciencedeep-learningdeploymentdistributedhyperparameter-optimization
A curated list of awesome skills, hooks, slash-commands, agent orchestrators, applications, and plugins for Claude Code by Anthropic
★ 41,078Pythonupdated 2026-04-20agent-skillsagentic-codeagentic-codingai-workflow-optimizationai-workflows
AI agent toolkit: coding agent CLI, unified LLM API, TUI & web UI libraries, Slack bot, vLLM pods
★ 40,229TypeScriptupdated 2026-04-20
Powerful AI Client
★ 39,642TypeScriptupdated 2026-04-09assistantchatbotchatgptclaudecopilot
A generative speech model for daily dialogue.
★ 39,153Pythonupdated 2026-04-10agentchatchatgptchatttschinese
Opiniated RAG for integrating GenAI in your apps 🧠 Focus on your product rather than the RAG. Easy integration in existing products with customisation! Any LLM: GPT4, Groq, Llama. Any Vectorstore: PGVector, Faiss. Any Files. Anyway you want.
★ 39,126Pythonupdated 2025-07-09aiapichatbotchatgptdatabase
AI Data Vault - A query engine for AI Agents to securely query data from any datasource
★ 39,054Pythonupdated 2026-04-20agentsaianalyticsartificial-inteligencebigquery
Extracted system prompts from ChatGPT (GPT-5.4, GPT-5.3, Codex), Claude (Opus 4.6, Sonnet 4.6, Claude Code), Gemini (3.1 Pro, 3 Flash, CLI), Grok (4.2, 4), Perplexity, and more. Updated regularly.
★ 38,856updated 2026-04-18aiai-transparencyanthropicchatgptclaude
Integrate the DeepSeek API into popular software
★ 36,560updated 2026-02-23awesomedeepseek
🤖 Assemble, configure, and deploy autonomous AI Agents in your browser.
★ 36,030TypeScriptupdated 2025-04-29agentagentgptagentsagiai
Enhanced ChatGPT Clone: Features Agents, MCP, DeepSeek, Anthropic, AWS, OpenAI, Responses API, Azure, Groq, o1, GPT-5, Mistral, OpenRouter, Vertex AI, Gemini, Artifacts, AI model switching, message search, Code Interpreter, langchain, DALL-E-3, OpenAPI Actions, Functions, Secure Multi-User Auth, Presets, open-source for self-hosting. Active.
★ 36,001TypeScriptupdated 2026-04-20aianthropicartifactsawsazure
🔥 1Panel is a modern, open-source VPS control panel — and the only one with native AI agent support. Run Ollama models, deploy OpenClaw agents, and manage your entire server stack from one clean web interface.
★ 35,173Goupdated 2026-04-20agentclawdbotcopawdockerdocker-ui
Your AI second brain. Self-hostable. Get answers from the web or your docs. Build custom agents, schedule automations, do deep research. Turn any online or local LLM into your personal, autonomous AI (gpt, claude, gemini, llama, qwen, mistral). Get started - free.
★ 34,251Pythonupdated 2026-03-26agentaiassistantchatchatgpt
In-depth tutorials on LLMs, RAGs and real-world AI agent applications.
★ 34,110Jupyter Notebookupdated 2026-03-23agentsaillmsmachine-learningmcp
Vane is an AI-powered answering engine.
★ 33,989TypeScriptupdated 2026-04-11ai-agentsai-search-engineanswering-engineartificial-intelligencellm
The first real AI developer
★ 33,775Pythonupdated 2026-04-17aicodegencoding-assistantdeveloper-toolsgpt-4
Self-hosted AI coding assistant
★ 33,463Rustupdated 2026-03-02aicodegencoding-assistantcoding-languagedeveloper-experience
🌊 The leading agent orchestration platform for Claude. Deploy intelligent multi-agent swarms, coordinate autonomous workflows, and build conversational AI systems. Features enterprise-grade architecture, distributed swarm intelligence, RAG integration, and native Claude Code / Codex Integration
★ 33,399TypeScriptupdated 2026-04-11agentic-aiagentic-engineeringagentic-frameworkagentic-ragagentic-workflow
CLIP (Contrastive Language-Image Pretraining), Predict the most relevant text snippet given an image
★ 33,327Jupyter Notebookupdated 2026-03-25deep-learningmachine-learning
ChatDev 2.0: Dev All through LLM-powered Multi-Agent Collaboration
★ 32,884Pythonupdated 2026-04-07
LLM API 管理 & 分发系统,支持 OpenAI、Azure、Anthropic Claude、Google Gemini、DeepSeek、字节豆包、ChatGLM、文心一言、讯飞星火、通义千问、360 智脑、腾讯混元等主流模型,统一 API 适配,可用于 key 管理与二次分发。单可执行文件,提供 Docker 镜像,一键部署,开箱即用。LLM API management & key redistribution system, unifying multiple providers under a single API. Single binary, Docker-ready, with an English UI.
★ 32,539JavaScriptupdated 2026-01-09apiapi-gatewayazure-openai-apichatgptclaude
Community-contributed instructions, agents, skills, and configurations to help you make the most of GitHub Copilot.
★ 31,229Pythonupdated 2026-04-20agent-skillsagentsaiawesomecustom-agents
The official Python library for the OpenAI API
★ 30,599Pythonupdated 2026-04-17openaipython
The Frontend Stack for Agents & Generative UI. React + Angular. Makers of the AG-UI Protocol
★ 30,442TypeScriptupdated 2026-04-20agentagent-nativeagentic-aiagentsai
Build resilient language agents as graphs.
★ 30,406Pythonupdated 2026-04-19agentsaiai-agentschatgptdeepagents
SOTA Open Source TTS
★ 29,936Pythonupdated 2026-04-06llamatransformerttsvallevits
AIHawk aims to easy job hunt process by automating the job application process. Utilizing artificial intelligence, it enables users to apply for multiple jobs in a tailored way.
★ 29,714Pythonupdated 2025-11-16agentapplication-resumeartificial-intelligenceautomateautomation
A unified AI model hub for aggregation & distribution. It supports cross-converting various LLMs into OpenAI-compatible, Claude-compatible, or Gemini-compatible formats. A centralized gateway for personal and enterprise model management. 🍥
★ 28,941Goupdated 2026-04-18ai-gatewayclaudedeepseekgemininewapi
Wrap Gemini CLI, Antigravity, ChatGPT Codex, Claude Code as an OpenAI/Gemini/Claude/Codex compatible API service, allowing you to enjoy the free Gemini 2.5 Pro, GPT 5, Claude model through API
★ 28,783Goupdated 2026-04-20antigravityclaude-codecluadecodexgemini
Open Source AI Platform - AI Chat with advanced features that works with every LLM
★ 28,514Pythonupdated 2026-04-20aiai-chatchatgptchatuienterprise-search
An LLM-powered knowledge curation system that researches a topic and generates a full-length report with citations.
★ 28,130Pythonupdated 2025-09-30agentic-ragdeep-researchemnlp2024knowledge-curationlarge-language-models
Composio powers 1000+ toolkits, tool search, context management, authentication, and a sandboxed workbench to help you build AI agents that turn intent into action.
★ 27,915TypeScriptupdated 2026-04-20agentic-aiagentsaiai-agentsaiagents
Build, deploy, and orchestrate AI agents. Sim is the central intelligence layer for your AI workforce.
★ 27,875TypeScriptupdated 2026-04-20agent-workflowagentic-workflowagentsaiaiagents
FastGPT is a knowledge-based platform built on the LLMs, offers a comprehensive suite of out-of-the-box capabilities such as data processing, RAG retrieval, and visual AI workflow orchestration, letting you easily develop and deploy complex question-answering systems without the need for extensive setup or configuration.
★ 27,833TypeScriptupdated 2026-04-20agentclaudedeepseekllmmcp
Integrate cutting-edge LLM technology quickly and easily into your apps
★ 27,786C#updated 2026-04-20aiartificial-intelligencellmopenaisdk
A list of AI autonomous agents
★ 27,483updated 2025-02-26agentaiartificial-intelligenceautogptautonomous-agents
This repository showcases various advanced techniques for Retrieval-Augmented Generation (RAG) systems. Each technique has a detailed notebook tutorial.
★ 26,982Jupyter Notebookupdated 2026-04-15aiembeddingslangchainllama-indexllm
An autonomous agent that conducts deep research on any data using any LLM providers
★ 26,707Pythonupdated 2026-04-16agentaiautomationdeepresearchllms
Awesome-LLM: a curated list of Large Language Model
★ 26,695updated 2025-07-31
Agent skills for Obsidian. Teach your agent to use Markdown, Bases, JSON Canvas, and use the CLI.
★ 26,471updated 2026-04-02claudeclawdbotclicodexdefuddle
A one stop repository for generative AI research updates, interview resources, notebooks and much more!
★ 26,366HTMLupdated 2026-04-19awesomeawesome-listgenerative-aiinterview-questionslarge-language-models
Find secrets with Gitleaks 🔑
★ 26,291Goupdated 2026-03-25ai-poweredci-cdcicdclidata-loss-prevention
LLM Frontend for Power Users.
★ 26,268JavaScriptupdated 2026-04-19aichatllm
Fully Local Manus AI. No APIs, No $200 monthly bills. Enjoy an autonomous agent that thinks, browses the web, and code for the sole cost of electricity. 🔔 Official updates only via twitter @Martin993886460 (Beware of fake account)
★ 26,085Pythonupdated 2026-04-11agentic-aiagentsaiautonomous-agentsdeepseek-r1
🪢 Open source LLM engineering platform: LLM Observability, metrics, evals, prompt management, playground, datasets. Integrates with OpenTelemetry, Langchain, OpenAI SDK, LiteLLM, and more. 🍊YC W23
★ 26,083TypeScriptupdated 2026-04-20analyticsautogenevaluationlangchainlarge-language-models
The open source AI engineering platform for agents, LLMs, and ML models. MLflow enables teams of all sizes to debug, evaluate, monitor, and optimize production-quality AI applications while controlling costs and managing access to models and data.
★ 25,566Pythonupdated 2026-04-20agentopsagentsaiai-governanceapache-spark
Google Workspace CLI — one command-line tool for Drive, Gmail, Calendar, Sheets, Docs, Chat, Admin, and more. Dynamically built from Google Discovery Service. Includes AI agent skills.
★ 25,395Rustupdated 2026-04-20agent-skillsai-agentautomationclidiscovery-api
Build Real-Time Knowledge Graphs for AI Agents
★ 25,389Pythonupdated 2026-04-18agentsgraphllmsrag
An open-source RAG-based tool for chatting with your documents.
★ 25,310Pythonupdated 2026-04-03chatbotllmsopen-sourcerag
A lightweight, powerful framework for multi-agent workflows
★ 25,199Pythonupdated 2026-04-20agentsaiframeworkllmopenai
Open-source AI orchestration framework for building context-engineered, production-ready LLM applications. Design modular pipelines and agent workflows with explicit control over retrieval, routing, memory, and generation. Built for scalable agents, RAG, multimodal applications, semantic search, and conversational systems.
★ 24,992MDXupdated 2026-04-20agentagentsaigeminigenerative-ai
🚀 The fast, Pythonic way to build MCP servers and clients.
★ 24,853Pythonupdated 2026-04-20agentsfastmcpllmsmcpmcp-clients
Marketing skills for Claude Code and AI agents. CRO, copywriting, SEO, analytics, and growth engineering.
★ 24,794JavaScriptupdated 2026-04-13claudecodexmarketing
Open-source AI hackers to find and fix your app’s vulnerabilities.
★ 24,581Pythonupdated 2026-04-16agentsartificial-intelligencecybersecuritygenerative-aillm
Build and run agents you can see, understand and trust.
★ 24,347Pythonupdated 2026-04-20agentchatbotlarge-language-modelsllmllm-agent
Distribute and run LLMs with a single file.
★ 24,274C++updated 2026-04-17cross-platformggufllama-cpplocal-ailocal-inference
🎒 Token-Oriented Object Notation (TOON) – Compact, human-readable, schema-aware JSON for LLM prompts. Spec, benchmarks, TypeScript SDK.
★ 24,021TypeScriptupdated 2026-04-16data-formatllmserializationtokenization
📦 Repomix is a powerful tool that packs your entire repository into a single, AI-friendly file. Perfect for when you need to feed your codebase to Large Language Models (LLMs) or other AI tools like Claude, ChatGPT, DeepSeek, Perplexity, Gemini, Gemma, Llama, Grok, and more.
★ 23,881TypeScriptupdated 2026-04-20aianthropicartificial-intelligencechatbotchatgpt
The AI Toolkit for TypeScript. From the creators of Next.js, the AI SDK is a free open-source library for building AI-powered applications and agents
★ 23,793TypeScriptupdated 2026-04-20anthropicartificial-intelligencegeminigenerative-aigenerative-ui
Glamourous agentic coding for all 💘
★ 23,501Goupdated 2026-04-20agentic-aiaillmsravishing
Chat with your database or your datalake (SQL, CSV, parquet). PandasAI makes data analysis conversational using LLMs and RAG.
★ 23,485Pythonupdated 2025-10-28aicsvdatadata-analysisdata-science
Agent2Agent (A2A) is an open protocol enabling communication and interoperability between opaque agentic applications.
★ 23,428Shellupdated 2026-04-19a2aa2a-mcpa2a-protocola2a-serveragents
A powerful MCP toolkit for coding, providing semantic retrieval and editing capabilities - the IDE for your agent
★ 23,423Pythonupdated 2026-04-20agentaiai-codingclaudeclaude-code
Python scraper based on AI
★ 23,388Pythonupdated 2026-04-19ai-crawlerai-scrapingai-searchcrawlerdata-extraction
From the team behind Gatsby, Mastra is a framework for building AI-powered applications and agents with a modern TypeScript stack.
★ 23,325TypeScriptupdated 2026-04-20agentsaichatbotsevalsjavascript
DeepSeek Coder: Let the Code Write Itself
★ 23,121Pythonupdated 2025-11-11
OpenViking is an open-source context database designed specifically for AI Agents(such as openclaw). OpenViking unifies the management of context (memory, resources, and skills) that Agents need through a file system paradigm, enabling hierarchical context delivery and self-evolving.
★ 23,068Pythonupdated 2026-04-20agentagentic-ragai-agentsclawbotcontext-database
Free, local, open-source 24/7 Cowork app and OpenClaw for Gemini CLI, Claude Code, Codex, OpenCode, Qwen Code, Goose CLI, Auggie, and more | 🌟 Star if you like it!
★ 22,574TypeScriptupdated 2026-04-20acpaiai-agentchatchatbot
Universal LLM Deployment Engine with ML Compilation
★ 22,526Pythonupdated 2026-04-20language-modelllmmachine-learning-compilationtvm
Faster Whisper transcription with CTranslate2
★ 22,404Pythonupdated 2025-11-19deep-learninginferenceopenaiquantizationspeech-recognition
A curated collection of fun and creative examples generated with Nano Banana & Nano Banana Pro🍌, Gemini-2.5-flash-image based model. We also release Nano-consistent-150K openly to support the community's development of image generation and unified models(click to website to see our blog)
★ 22,396updated 2025-12-12awesomegemini-2-5-flash-imagenano-banana
The SDK For Browser Agents
★ 22,339TypeScriptupdated 2026-04-19agentsaillmsplaywrightpuppeteer
Letta is the platform for building stateful agents: AI with advanced memory that can learn and self-improve over time.
★ 22,293Pythonupdated 2026-04-12aiai-agentsllmllm-agent
OpenUI let's you describe UI using your imagination, then see it rendered live.
★ 22,257TypeScriptupdated 2026-02-11aigenerative-aihtml-css-javascripttailwindcss
Crawl a site to generate knowledge files to create your own custom GPT from a URL
★ 22,241TypeScriptupdated 2025-07-07ai
Chat with your documents on your local device using GPT models. No data leaves your device and 100% private.
★ 22,206Pythonupdated 2026-03-10
A powerful GUI app and Toolkit for Claude Code - Create custom agents, manage interactive Claude Code sessions, run secure background agents, and more.
★ 21,657TypeScriptupdated 2025-10-16anthropicanthropic-claudeclaudeclaude-4claude-4-opus
280+ free n8n automation templates — ready-to-use workflows for Gmail, Telegram, Slack, Discord, WhatsApp, Google Drive, Notion, OpenAI, and more. AI agents, RAG chatbots, email automation, social media, DevOps, and document processing. The largest open-source n8n template collection.
★ 21,599updated 2026-04-09ai-agentsai-automationautomationautomation-templatesawesome
50+ tutorials and implementations for Generative AI Agent techniques, from basic conversational bots to complex multi-agent systems.
★ 21,566Jupyter Notebookupdated 2026-04-15agentsaiai-agentsgenailangchain
🤗 The largest hub of ready-to-use datasets for AI models with fast, easy-to-use and efficient data manipulation tools
★ 21,453Pythonupdated 2026-04-17aiartificial-intelligencecomputer-visiondataset-hubdatasets
Educational framework exploring ergonomic, lightweight multi-agent orchestration. Managed by OpenAI Solution team.
★ 21,389Pythonupdated 2026-04-15
Automate browser based workflows with AI
★ 21,386Pythonupdated 2026-04-20aiapiautomationbrowserbrowser-automation
The official repo of Qwen (通义千问) chat & pretrained large language model proposed by Alibaba Cloud.
★ 21,071Pythonupdated 2026-03-05chineseflash-attentionlarge-language-modelsllmnatural-language-processing
🔥 MaxKB is an open-source platform for building enterprise-grade agents. 强大易用的开源企业级智能体平台。
★ 20,809Pythonupdated 2026-04-20agentagentic-aichatbotdeepseek-r1knowledgebase
An AI agent development platform with all-in-one visual tools, simplifying agent creation, debugging, and deployment like never before. Coze your way to AI Agent creation.
★ 20,627TypeScriptupdated 2026-04-20agentagent-platformai-pluginschatbotchatbot-framework
Test your prompts, agents, and RAGs. Red teaming/pentesting/vulnerability scanning for AI. Compare performance of GPT, Claude, Gemini, Llama, and more. Simple declarative configs with command line and CI/CD integration. Used by OpenAI and Anthropic.
★ 20,570TypeScriptupdated 2026-04-20cici-cdcicdevaluationevaluation-framework
A full-featured, hackable Next.js AI chatbot built by Vercel
★ 20,184TypeScriptupdated 2026-04-17aichatgptnextjsreactredis
Local, open-source AI app builder for power users ✨ v0 / Lovable / Replit / Bolt alternative 🌟 Star if you like it!
★ 20,177TypeScriptupdated 2026-04-18ai-app-builderanthropicartificial-intelligenceboltdeepseek
FinGPT: Open-Source Financial Large Language Models! Revolutionize 🔥 We release the trained model on HuggingFace.
★ 19,816Jupyter Notebookupdated 2026-04-19chatgptfinancefingptfintechlarge-language-models
The Autonomous Company Operating System
★ 19,655TypeScriptupdated 2026-04-20aiai-agentsllm
What are the principles we can use to build LLM-powered software that is actually good enough to put in the hands of production customers?
★ 19,489TypeScriptupdated 2025-09-2112-factor12-factor-agentsagentsaicontext-window
A list of free LLM inference resources accessible via API.
★ 19,373Pythonupdated 2026-04-19aiclaudegeminillamallm
Prompt, run, edit, and deploy full-stack web applications using any LLM you want!
★ 19,287TypeScriptupdated 2026-02-07
An open-source, code-first Python toolkit for building, evaluating, and deploying sophisticated AI agents with flexibility and control.
★ 19,274Pythonupdated 2026-04-20agentagenticagentic-aiagentsagents-sdk
Mobile and Web client for Codex and Claude Code, with realtime voice, encryption and fully featured
★ 19,170TypeScriptupdated 2026-04-20claude-codeclaude-desktopclaude-mobilecodexcodex-cli
SWE-agent takes a GitHub issue and tries to automatically fix it, using your LM of choice. It can also be employed for offensive cybersecurity or competitive coding challenges. [NeurIPS 2024]
★ 19,059Pythonupdated 2026-04-13agentagent-based-modelaicybersecuritydeveloper-tools
Debug, evaluate, and monitor your LLM applications, RAG systems, and agentic workflows with comprehensive tracing, automated evaluations, and production-ready dashboards.
★ 19,052Pythonupdated 2026-04-20evaluationhacktoberfesthacktoberfest2025langchainllama-index
Instruct-tune LLaMA on consumer hardware
★ 18,943Jupyter Notebookupdated 2024-07-29
End-to-end, code-first tutorials for building production-grade GenAI agents. From prototype to enterprise deployment.
★ 18,915Jupyter Notebookupdated 2026-04-15agentagent-frameworkagentsai-agentsdeployment
Buzz transcribes and translates audio offline on your personal computer. Powered by OpenAI's Whisper.
★ 18,900Pythonupdated 2026-04-19whisper
An AI-powered research assistant that performs iterative, deep research on any topic by combining search engines, web scraping, and large language models. The goal of this repo is to provide the simplest implementation of a deep research agent - e.g. an agent that can refine its research direction overtime and deep dive into a topic.
★ 18,812TypeScriptupdated 2026-04-11agentaigpto3-miniresearch
Tongyi Deep Research, the Leading Open-source Deep Research Agent
★ 18,746Pythonupdated 2026-02-27agentalibabaartificial-intelligencedeep-researchdeepresearch
open-source agentic AI data assistant for the next generation of AI + Data products.
★ 18,604Pythonupdated 2026-04-03agentsbgidatabasedeepseekgpt
Kilo is the all-in-one agentic engineering platform. Build, ship, and iterate faster with the most popular open source coding agent.
★ 18,577TypeScriptupdated 2026-04-20aiai-ageai-codingai-developer-toolschatgpt
Run agents that work for you based on what you do. AI finally knows what you are doing
★ 18,404Rustupdated 2026-04-20agentsagiaicomputer-visionllm
Welcome to the Llama Cookbook! This is your go to guide for Building with Llama: Getting started with Inference, Fine-Tuning, RAG. We also show you how to solve end to end problems using Llama model family and using them on various provider services
★ 18,303Jupyter Notebookupdated 2026-04-17aifinetuninglangchainllamallama2
Evals is a framework for evaluating LLMs and LLM systems, and an open-source registry of benchmarks.
★ 18,276Pythonupdated 2026-04-14
Autonomous agents for everyone
★ 18,242TypeScriptupdated 2026-04-20agentagenticaiautonomouschatbot
Give your AI agent eyes to see the entire internet. Read & search Twitter, Reddit, YouTube, GitHub, Bilibili, XiaoHongShu — one CLI, zero API fees.
★ 18,240Pythonupdated 2026-04-13agent-infrastructureai-agentai-searchautomationbilibili
Your API ⇒ Paid MCP. Instantly.
★ 18,130TypeScriptupdated 2026-02-11agentsaillmsopenai
Get started with building Fullstack Agents using Gemini 2.5 and LangGraph
★ 18,121Jupyter Notebookupdated 2026-04-16geminigemini-api
The interaction control harness for customer-facing AI agents - optimized for building controlled, consistent, and predictable customer interactions with LLMs.
★ 18,021Pythonupdated 2026-04-19ai-agentsai-alignmentcustomer-servicecustomer-successgemini
Private AI platform for agents, assistants and enterprise search. Built-in Agent Builder, Deep research, Document analysis, Multi-model support, and API connectivity for agents.
★ 17,849Pythonupdated 2026-04-20agent-builderagentsaichatgptdocsgpt
LLM Council works together to answer your hardest questions
★ 17,710Pythonupdated 2025-11-22
Janus-Series: Unified Multimodal Understanding and Generation Models
★ 17,700Pythonupdated 2025-02-01any-to-anyfoundation-modelsllmmultimodalunified-model
🚀 One-stop solution for creating your AI twin from chat history 💡 Fine-tune LLMs with your chat logs to capture your unique style, then bind to a chatbot to bring your digital self to life. 从聊天记录创造数字分身的一站式解决方案
★ 17,652Pythonupdated 2026-04-14chat-historydigital-avatarllmqwentelegram
<⚡️> SuperAGI - A dev-first open source autonomous AI agent framework. Enabling developers to build, manage & run useful autonomous agents quickly and reliably.
★ 17,479Pythonupdated 2025-01-22agentsagiaiartificial-general-intelligenceartificial-intelligence
🧠 Leon is your open-source personal assistant.
★ 17,188TypeScriptupdated 2026-04-19aiai-assistantartificial-intelligenceassistantautomation
A scalable generative AI framework built for researchers and developers working on Large Language Models, Multimodal, and Speech AI (Automatic Speech Recognition and Text-to-Speech)
★ 17,126Pythonupdated 2026-04-20asrdeeplearninggenerative-aimachine-translationneural-networks
Examples and guides for using the Gemini API
★ 17,088Jupyter Notebookupdated 2026-04-20geminigemini-api
The absolute trainer to light up AI agents.
★ 17,028Pythonupdated 2026-04-03agentagentic-aillmmlopsreinforcement-learning
Open-source Agent Operating System
★ 17,018Rustupdated 2026-04-19agent-frameworkai-agentsllmmcpopen-source
🐫 CAMEL: The first and the best multi-agent framework. Finding the Scaling Law of Agents. https://www.camel-ai.org
★ 16,793Pythonupdated 2026-04-19agentai-societiesartificial-intelligencecommunicative-aicooperative-ai
Knowledge Engine for AI Agent Memory in 6 lines of code
★ 16,781Pythonupdated 2026-04-20aiai-agentsai-memorycognitive-architecturecognitive-memory
Sample code and notebooks for Generative AI on Google Cloud, with Gemini Enterprise Agent Platform
★ 16,723Jupyter Notebookupdated 2026-04-17agentsgcpgeminigemini-apigen-ai
AI Agent Framework, the Pydantic way
★ 16,636Pythonupdated 2026-04-20agent-frameworkgenaillmpydanticpython
Prompt, run, edit, and deploy full-stack web applications. -- bolt.new -- Help Center: https://support.bolt.new/ -- Community Support: https://discord.com/invite/stackblitz
★ 16,347TypeScriptupdated 2024-12-17ai-playgroundanthropicchatbotwebcontainers-api
Inference code for CodeLlama models
★ 16,335Pythonupdated 2024-08-12
Python SDK for Agent AI Observability, Monitoring and Evaluation Framework. Includes features like agent, llm and tools tracing, debugging multi-agentic system, self-hosted dashboard and advanced analytics with timeline and execution graph view
★ 16,142Pythonupdated 2026-02-11agentic-aiagentic-ai-developmentagentneoagentsai-agent-monitoring
Fully autonomous AI Agents system capable of performing complex penetration testing tasks
★ 15,657Goupdated 2026-04-16ai-agentsai-security-toolanthropicautonomous-agentsgolang
🏛️ 三省六部制 · OpenClaw Multi-Agent Orchestration System — 9 specialized AI agents with real-time dashboard, model config, and full audit trails
★ 15,460Pythonupdated 2026-04-19ai-agentsai-orchestrationautonomous-agentsclaudedashboard
Open source AI coding agent. Designed for large projects and real world tasks.
★ 15,293Goupdated 2025-10-03aiai-agentsai-developer-toolsai-toolscli
"DeepCode: Open Agentic Coding (Paper2Code & Text2Web & Text2Backend)"
★ 15,270Pythonupdated 2026-04-20agentic-codingllm-agent
Open-source text-to-SQL and text-to-chart GenBI agent with a semantic layer. Ask your database questions in natural language — get accurate SQL, charts, and BI insights. Supports 12+ data sources (PostgreSQL, BigQuery, Snowflake, etc.) and any LLM (OpenAI, Claude, Gemini, Ollama).
★ 15,013TypeScriptupdated 2026-04-16agentanthropicbedrockbigquerybusiness-intelligence
The LLM Evaluation Framework
★ 14,989Pythonupdated 2026-04-20evaluation-frameworkevaluation-metricsllm-evaluationllm-evaluation-frameworkllm-evaluation-metrics
FinRL®: Financial Reinforcement Learning. 🔥
★ 14,920Jupyter Notebookupdated 2026-04-05algorithmic-tradingdeep-reinforcement-learningdrl-algorithmsdrl-frameworkdrl-trading-agents
MCP Toolbox for Databases is an open source MCP server for databases.
★ 14,815Goupdated 2026-04-20agentagentsaibigqueryclickhouse
The open-source hub to build & deploy GPT/LLM Agents ⚡️
★ 14,652TypeScriptupdated 2026-04-17agentaibotpresschatbotchatgpt
Convert documents to structured data effortlessly. Unstructured is open-source ETL solution for transforming complex documents into clean, structured formats for language models. Visit our website to learn more about our enterprise grade Platform product for production grade workflows, partitioning, enrichments, chunking and embedding.
★ 14,559HTMLupdated 2026-04-14data-pipelinesdeep-learningdocument-image-analysisdocument-image-processingdocument-parser
Collection of leaked system prompts
★ 14,512updated 2026-03-30aidocumentllmprompt
A 100% free modern JS SaaS boilerplate (React, NodeJS, Prisma). Full-featured: Auth (email, google, github, slack, MS), Email sending, Background jobs, Landing page, Payments (Stripe, Polar.sh), Shadcn UI, S3 file upload. AI-ready with tailored AGENTS.md, skills, and Claude Code plugin. One cmd deploy. Powered by Wasp full-stack framework.
★ 14,261TypeScriptupdated 2026-04-16aiauthenticationaws-s3boilerplatechatgpt
A powerful tool for creating datasets for LLM fine-tuning 、RAG and Eval
★ 14,068JavaScriptupdated 2026-04-10datasetfine-tuningjavascriptllmrag
LLM-powered framework for deep document understanding, semantic retrieval, and context-aware answers using RAG paradigm.
★ 14,005Goupdated 2026-04-20agentagenticaichatbotchatbots
An open source, privacy focused alternative to NotebookLM for teams with no data limits. Join our Discord: https://discord.gg/ejRNvftDp9
★ 13,996Pythonupdated 2026-04-18agentagentsaichrome-extensionextension
Memori is agent-native memory infrastructure. A LLM-agnostic layer that turns agent execution and conversation into structured, persistent state for production systems.
★ 13,868Pythonupdated 2026-04-17agentagent-memoryaiai-memoryaiagent
An open-source Agent-first Identity and Access Management (IAM) /LLM MCP & agent gateway and auth server with web UI supporting OpenClaw, MCP, OAuth, OIDC, SAML, CAS, LDAP, SCIM, WebAuthn, TOTP, MFA, Face ID, Google Workspace, Azure AD
★ 13,483Goupdated 2026-04-20agentagentic-aiagiai-gatewayauth
20+ high-performance LLMs with recipes to pretrain, finetune and deploy at scale.
★ 13,326Pythonupdated 2026-04-16aiartificial-intelligencedeep-learninglarge-language-modelsllm
Open-source AI coworker, with memory
★ 13,101TypeScriptupdated 2026-04-20agentsagents-sdkaiai-agentsai-agents-automation
The simplest way to run LLaMA on your local machine
★ 12,953CSSupdated 2024-06-18aillamallm
Gorilla: Training and Evaluating LLMs for Function Calls (Tool Calls)
★ 12,851Pythonupdated 2026-04-13apiapi-documentationchatgptclaude-apigpt-4-api
AI-powered, vision-driven UI automation for every platform.
★ 12,804TypeScriptupdated 2026-04-20aiai-testbrowser-usecomputer-usegpt-operator
Open-Source Chrome extension for AI-powered web automation. Run multi-agent workflows using your own LLM API key. Alternative to OpenAI Operator.
★ 12,774TypeScriptupdated 2025-11-24agentaiai-agentsai-toolsautomation
📋 A list of open LLMs available for commercial use.
★ 12,739updated 2025-02-13commerciallarge-language-modelsllmllms
text and image to video generation: CogVideoX (2024) and CogVideo (ICLR 2023)
★ 12,679Pythonupdated 2025-11-04cogvideoximage-to-videollmsoratext-to-video
💡 All-in-one AI framework for semantic search, LLM orchestration and language model workflows
★ 12,424Pythonupdated 2026-04-14agentsaiai-agentsembeddingsinformation-retrieval
Run any open-source LLMs, such as DeepSeek and Llama, as OpenAI compatible API endpoint in the cloud.
★ 12,298Pythonupdated 2026-04-13bentomlfine-tuningllamallama2llama3-1
A command-line productivity tool powered by AI large language models like GPT-5, will help you accomplish your tasks faster and more efficiently.
★ 12,013Pythonupdated 2026-04-11chatgptcheat-sheetclicommandsgpt-3
Build Conversational AI in minutes ⚡️
★ 12,005Pythonupdated 2026-04-09chatgptlangchainllmopenaiopenai-chatgpt
LangGPT: Empowering everyone to become a prompt expert! 🚀 📌 结构化提示词(Structured Prompt)提出者 📌 元提示词(Meta-Prompt)发起者 📌 最流行的提示词落地范式 | Language of GPT The pioneering framework for structured & meta-prompt design 10,000+ ⭐ | Battle-tested by thousands of users worldwide Created by 云中江树
★ 11,976Jupyter Notebookupdated 2026-01-30chatgptclaudedeeplearningdoubaoframework
Open-source, secure environment with real-world tools for enterprise-grade agents.
★ 11,922Pythonupdated 2026-04-17agentaiai-agentai-agentscode-interpreter
A curated list of modern Generative Artificial Intelligence projects and services
★ 11,907updated 2026-04-18aiartificial-intelligenceawesomeawesome-listgenerative-ai
Expose your FastAPI endpoints as Model Context Protocol (MCP) tools, with Auth!
★ 11,824Pythonupdated 2025-11-24aiauthenticationauthorizationclaudecursor
Go ahead and axolotl questions
★ 11,770Pythonupdated 2026-04-20fine-tuningllm
Access large language models from the command-line
★ 11,713Pythonupdated 2026-04-15aillmsopenai
Low-code framework for building custom LLMs, neural networks, and other AI models
★ 11,677Pythonupdated 2026-04-19computer-visiondata-centricdata-sciencedeepdeep-learning
Fully autonomous & self-evolving research from idea to paper. Chat an Idea. Get a Paper. 🦞
★ 11,636Pythonupdated 2026-04-10autonomous-researchcitation-verificationllm-agentsmetaclawmulti-agent-debate
🍌 World's largest Nano Banana Pro prompt library — 10,000+ curated prompts with preview images, 16 languages. Google Gemini AI image generation. Free & open source.
★ 11,581TypeScriptupdated 2026-04-20ai-image-generationai-promptsawesomeawesome-listgemini
The power of Claude Code / GeminiCLI / CodexCLI + [Gemini / OpenAI / OpenRouter / Azure / Grok / Ollama / Custom Model / All Of The Above] working as one.
★ 11,472Pythonupdated 2025-12-15
A blazing fast AI Gateway with integrated guardrails. Route to 200+ LLMs, 50+ AI Guardrails with 1 fast & friendly API.
★ 11,450TypeScriptupdated 2026-03-25ai-gatewaygatewaygenerative-aihacktoberfestlangchain
Trae Agent is an LLM-based agent for general purpose software engineering tasks.
★ 11,403Pythonupdated 2026-02-05agentllmsoftware-engineering
Privacy first, AI meeting assistant with 4x faster Parakeet/Whisper live transcription, speaker diarization, and Ollama summarization built on Rust. 100% local processing. no cloud required. Meetily (Meetly Ai - https://meetily.ai) is the #1 Self-hosted, Open-source Ai meeting note taker for macOS & Windows.
★ 11,335Rustupdated 2026-03-16aiai-meeting-assistantllmlocal-aimac
A cross-platform Markdown AI note-taking software.
★ 11,313TypeScriptupdated 2026-04-16agentchatbotknowledge-basellmmarkdown
TensorZero is an open-source LLMOps platform that unifies an LLM gateway, observability, evaluation, optimization, and experimentation.
★ 11,278Rustupdated 2026-04-19aiai-engineeringanthropicartificial-intelligencedeep-learning
Build high-quality LLM apps - from prototyping, testing to production deployment and monitoring.
★ 11,109Pythonupdated 2026-04-20aiai-application-developmentai-applicationschatgptgpt
Bytebot is a self-hosted AI desktop agent that automates computer tasks through natural language commands, operating within a containerized Linux desktop environment.
★ 10,865TypeScriptupdated 2025-09-12agentagentic-aiagentsaiai-agents
Large Language Model Text Generation Inference
★ 10,844Pythonupdated 2026-03-21bloomdeep-learningfalcongptinference
The open source codebase powering HuggingChat
★ 10,675TypeScriptupdated 2026-04-17chatgpthacktoberfesthuggingfacellmsvelte
Convert any URL to an LLM-friendly input with a simple prefix https://r.jina.ai/
★ 10,671TypeScriptupdated 2026-04-16llmproxy
🌐 The open-source Agentic browser; alternative to ChatGPT Atlas, Perplexity Comet, Dia.
★ 10,648TypeScriptupdated 2026-04-19agentbrowserbrowseroschromiumhacktoberfest
The best way to get AI coding agents to solve hard problems in complex codebases.
★ 10,592TypeScriptupdated 2026-03-07agentsaiampclaude-codecodex
A collection of GPT system prompts and various prompt injection/leaking knowledge.
★ 10,537HTMLupdated 2026-04-19gptpromptprompt-engineering
The world's best AI personal assistant for email. Open source app to help you reach inbox zero fast.
★ 10,536TypeScriptupdated 2026-04-20aiemailgmailloopsnextjs
Pocket Flow: 100-line LLM framework. Let Agents build Agents!
★ 10,466Pythonupdated 2026-03-27agentic-aiagentic-frameworkagentic-workflowagentsai-framework
High-performance GPGPU inference of OpenAI's Whisper automatic speech recognition (ASR) model
★ 10,356C++updated 2024-08-03
Run GGUF models easily with a KoboldAI UI. One File. Zero Install.
★ 10,309C++updated 2026-04-20gemmaggmlggufkoboldaikoboldcpp
A collection of projects showcasing RAG, agents, workflows, and other AI use cases
★ 10,258Pythonupdated 2026-04-20agentsaihacktoberfestllmmcp
A framework for building realtime voice AI agents 🤖🎙️📹
★ 10,222Pythonupdated 2026-04-20agentsaiopenaireal-timevideo
Context window optimization for AI coding agents. Sandboxes tool output, 98% reduction. 14 platforms
★ 10,172TypeScriptupdated 2026-04-20antigravityclaudeclaude-codeclaude-code-hooksclaude-code-plugins
OpenVINO™ is an open source toolkit for optimizing and deploying AI inference
★ 10,142C++updated 2026-04-20aicomputer-visiondeep-learningdeploy-aidiffusion-models
Multi-Agent Harness for Production AI
★ 10,141Pythonupdated 2026-04-20agentagent-frameworkagent-skillsanthropicautomation
An open-source, self-hosted personal AI note tool prioritizing privacy, built using TypeScript .
★ 10,128TypeScriptupdated 2026-04-15markdownmemosnextjsnotebookopenai
🌸 Run LLMs at home, BitTorrent-style. Fine-tuning and inference up to 10x faster than offloading
★ 10,090Pythonupdated 2024-09-07bloomchatbotdeep-learningdistributed-systemsfalcon
Build, Manage and Deploy AI/ML Systems
★ 10,056Pythonupdated 2026-04-20agentsaiawsazurecost-optimization
All-in-one LLM CLI tool featuring Shell Assistant, Chat-REPL, RAG, AI Tools & Agents, with access to OpenAI, Claude, Gemini, Ollama, Groq, and more.
★ 9,887Rustupdated 2026-02-23aiai-agentschatbotclaudecli
💬 Typebot is a powerful chatbot builder that you can self-host.
★ 9,883TypeScriptupdated 2026-04-20chat-applicationchatbotconversational-botsform-buildernextjs
🚀 An awesome list of curated Nano Banana pro prompts and examples. Your go-to resource for mastering prompt engineering and exploring the creative potential of the Nano banana pro(Nano banana 2) AI image model.
★ 9,828updated 2026-04-16gemininanobananananobanana-pronanobanana2nanobananapro
The fullstack MCP framework to develop MCP Apps for ChatGPT / Claude & MCP Servers for AI Agents.
★ 9,816TypeScriptupdated 2026-04-20agentic-frameworkaiapps-sdkchatgptclaude-code
Typescript/React Library for AI Chat💬🚀
★ 9,686TypeScriptupdated 2026-04-20ai-chatbotchatbotconversational-aicopilotradix-ui
★ 9,660Jupyter Notebookupdated 2025-10-16
An Open-Source Asynchronous Coding Agent
★ 9,659Pythonupdated 2026-04-19agentagentsaianthropicclaudecode
AI powered open source recommender system engine supports classical/LLM rankers and multimodal content via embedding
★ 9,619Goupdated 2026-04-22collaborative-filteringgoknnmachine-learningrecommender-system
Tips and tricks for working with Large Language Models like OpenAI's GPT-4.
★ 9,533updated 2023-10-23
AI Observability & Evaluation
★ 9,473Pythonupdated 2026-04-25agentsai-monitoringai-observabilityaiengineeringanthropic
Code search MCP for Claude Code. Make entire codebase the context for any coding agent.
★ 9,443TypeScriptupdated 2026-04-20agentagentic-ragai-codingclaude-codecode-generation
😎 Awesome list of tools and projects with the awesome LangChain framework
★ 9,306updated 2026-04-03aiawesomeawesome-listlangchainllm
Anomaly detection related books, papers, videos, and toolboxes. Last update late 2025 for LLM and VLM works!
★ 9,270Pythonupdated 2026-03-02anomaly-detectionawesomeawesome-listdata-miningfraud
Swap GPT for any LLM by changing a single line of code. Xinference lets you run open-source, speech, and multimodal models on cloud, on-prem, or your laptop — all through one unified, production-ready inference API.
★ 9,261Pythonupdated 2026-04-20artificial-intelligencechatglmdeploymentflan-t5gemma
Agent Reinforcement Trainer: train multi-step agents for real-world tasks using GRPO. Give your agents on-the-job training. Reinforcement learning for Qwen3.5, GPT-OSS, Llama, and more!
★ 9,244Pythonupdated 2026-04-18agentagentic-aigrpollmslora
"AutoAgent: Fully-Automated and Zero-Code LLM Agent Framework"
★ 9,221Pythonupdated 2025-10-16agentllms
Easily fine-tune, evaluate and deploy gpt-oss, Qwen3, DeepSeek-R1, or any open source LLM / VLM!
★ 9,209Pythonupdated 2026-04-24dpoevaluationfine-tuninggpt-ossgpt-oss-120b
Deeplake is AI Data Runtime for Agents. It provides serverless postgres with a multimodal datalake, enabling scalable retrieval and training.
★ 9,100C++updated 2026-02-16agentagentic-ragaiclawbotcomputer-vision
🚀 Less chaos. More flow.
★ 8,880TypeScriptupdated 2026-02-04aiapplicationbrowserchatgptclaude
An AI-powered search engine with a generative UI
★ 8,790TypeScriptupdated 2026-04-15deepseek-r1generative-aigenerative-uinextjsollama
AI memory OS for LLM and Agent systems(moltbot,clawdbot,openclaw), enabling persistent Skill memory for cross-task skill reuse and evolution.
★ 8,685TypeScriptupdated 2026-04-20agentagent-memoryclawdbotllmllm-memory
A Go implementation of the Model Context Protocol (MCP), enabling seamless integration between LLM applications and external data sources and tools.
★ 8,634Goupdated 2026-04-20
Private & local AI personal knowledge management app for high entropy people.
★ 8,558JavaScriptupdated 2025-05-13ailancedbllamallamacpplocal-first
An Autonomous LLM Agent for Complex Task Solving
★ 8,527Pythonupdated 2024-08-12
AI Agent Engineering Platform built on an Open Source TypeScript AI Agent Framework
★ 8,483TypeScriptupdated 2026-04-15agentsaiai-agentsai-agents-frameworkaiagentframework
Uncensored, open-source alternative to Higgsfield AI, Freepik AI, Krea AI, Openart AI — Free, unrestricted AI image & video generation studio with 200+ models (Flux, Midjourney, Kling, Sora, Veo). No content filters. Self-hosted, MIT licensed.
★ 8,455JavaScriptupdated 2026-04-23ai-art-generatorai-image-generationai-video-generationcreative-toolsflux-1
HexStrike AI MCP Agents is an advanced MCP server that lets AI agents (Claude, GPT, Copilot, etc.) autonomously run 150+ cybersecurity tools for automated pentesting, vulnerability discovery, bug bounty automation, and security research. Seamlessly bridge LLMs with real-world offensive security capabilities.
★ 8,298Pythonupdated 2026-03-060x4m4aiai-agentsai-cybersecurityai-hacking
Build effective agents using Model Context Protocol and simple workflow patterns
★ 8,291Pythonupdated 2026-01-25agentsaiai-agentsllmllms
Automate your mobile devices with natural language commands - an LLM agnostic mobile Agent 🤖
★ 8,216Pythonupdated 2026-04-17ai-agentsandroidandroid-automationhacktoberfestmobile-automation
Multilingual Voice Understanding Model
★ 8,041Pythonupdated 2025-12-30aiaigcasraudio-event-classificationcross-lingual
Put an end to code hallucinations! GitMCP is a free, open-source, remote MCP server for any GitHub project
★ 7,981TypeScriptupdated 2026-03-13agentic-aiagentsaiclaudecopilot
Run frontier LLMs and VLMs with day-0 model support across GPU, NPU, and CPU, with comprehensive runtime coverage for PC (Python/C++), mobile (Android & iOS), and Linux/IoT (Arm64 & x86 Docker). Supporting OpenAI GPT-OSS, IBM Granite-4, Qwen-3-VL, Gemma-3n, Ministral-3, and more.
★ 7,973Kotlinupdated 2026-04-14gemma3gogpt-ossgranite4llama
Build autonomous AI agents in Python.
★ 7,836Pythonupdated 2026-04-17agentagent-frameworkautonomous-agentautonomous-agentsclaude
Use your locally running AI models to assist you in your web browsing
★ 7,826TypeScriptupdated 2026-04-19chat-applicationchrome-extensionlocalllmollamaopen-source
LMDeploy is a toolkit for compressing, deploying, and serving LLMs.
★ 7,817Pythonupdated 2026-04-20codellamacuda-kernelsdeepspeedfastertransformerinternlm
Open Source Deep Research Alternative to Reason and Search on Private Data. Written in Python.
★ 7,784Pythonupdated 2025-11-19agentagentic-ragclaudedeep-researchdeepseek
SoTA production-ready AI retrieval system. Agentic Retrieval-Augmented Generation (RAG) with a RESTful API.
★ 7,775Pythonupdated 2025-11-07artificial-intelligencelarge-language-modelspythonquestion-answeringrag
OpenAI + LINE + Vercel = GPT AI Assistant
★ 7,744JavaScriptupdated 2024-07-09
Giving Kubernetes Superpowers to everyone
★ 7,710Goupdated 2026-04-20aidevopskubernetesllamaopenai
Sweep: AI coding assistant for JetBrains
★ 7,705Jupyter Notebookupdated 2025-09-18aiai-developerai-softwarai-softwarecode-assistant
Flexible and powerful framework for managing multiple AI agents and handling complex conversations
★ 7,587Pythonupdated 2026-04-17agentic-aiagentsai-agentsai-agents-frameworkanthropic
✨ Build AI agents and web apps — with a single binary.
★ 7,535Goupdated 2026-04-19agentagentic-aiagentsaiai-applications
22 prompt engineering techniques with hands-on Jupyter Notebook tutorials, from fundamental concepts to advanced strategies for leveraging LLMs.
★ 7,438Jupyter Notebookupdated 2026-04-15aichatgptclaudegenailangchain
Comprehensive open-source library of AI research and engineering skills for any AI model. Package the skills and your claude code/codex/gemini agent will be an AI research agent with full horsepower. Maintained by Orchestra Research.
★ 7,397TeXupdated 2026-04-13aiai-researchclaudeclaude-codeclaude-skills
File Parser optimised for LLM Ingestion with no loss 🧠 Parse PDFs, Docx, PPTx in a format that is ideal for LLMs.
★ 7,353Pythonupdated 2025-02-21docxllmparserpdfpowerpoint
A CLI tool to convert your codebase into a single LLM prompt with source tree, prompt templating, and token counting.
★ 7,302Rustupdated 2026-04-14aichatgptclaudeclicommand-line
Manage multiple AI terminal agents like Claude Code, Codex, OpenCode, and Amp.
★ 7,162Goupdated 2026-03-28claude-codeclicodexopencodevibe-coding
An open source library for deep learning end-to-end dialog systems and chatbots.
★ 6,975Pythonupdated 2025-08-06aiartificial-intelligencebotchatbotchitchat
AI enabled pair programmer for Claude, GPT, O Series, Grok, Deepseek, Gemini and 300+ models
★ 6,974Rustupdated 2026-04-20ai-pair-programmingai-workflowsartifical-intelligenseclaude-3-7-sonnetclaude-4
OpenCompass is an LLM evaluation platform, supporting a wide range of models (Llama3, Mistral, InternLM2,GPT-4,LLaMa2, Qwen,GLM, Claude, etc) over 100+ datasets.
★ 6,935Pythonupdated 2026-04-16benchmarkchatgptevaluationlarge-language-modelllama2
AI suite powered by state-of-the-art models and providing advanced AI/AGI functions. Includes AI personas, AGI functions, world-class Beam multi-model chats, text-to-image, voice, response streaming, code highlighting and execution, PDF import, presets for developers, much more. Deploy on-prem or in the cloud.
★ 6,935TypeScriptupdated 2026-04-20agiai-agentsai-suiteai-workspaceanthropic-api
🔥 Open Source Browser API for AI Agents & Apps. Steel Browser is a batteries-included browser sandbox that lets you automate the web without worrying about infrastructure.
★ 6,918TypeScriptupdated 2026-04-16aiai-agentsai-toolsbrowser-automationllm
An Open-Ended Embodied Agent with Large Language Models
★ 6,853JavaScriptupdated 2024-04-03embodied-learninglarge-language-modelsminecraftopen-ended-learning
🔍 An LLM-based Multi-agent Framework of Web Search Engine (like Perplexity.ai Pro and SearchGPT)
★ 6,851JavaScriptupdated 2025-07-04ai-search-enginegptllmllmsmulti-agent-systems
This is a simple demonstration of more advanced, agentic patterns built on top of the Realtime API.
★ 6,839TypeScriptupdated 2026-01-07
THE Copilot in Obsidian
★ 6,787TypeScriptupdated 2026-04-20aiaiagentchatgptcopilotobsidian-plugin
FinRobot: An Open-Source AI Agent Platform for Financial Analysis using LLMs 🚀 🚀 🚀
★ 6,777Jupyter Notebookupdated 2026-04-03aiagentchatgptfinancefingptlarge-language-models
free online AI resume editor,the only official website is https://magicv.art
★ 6,761TypeScriptupdated 2026-04-19aideepseekdoubaomotionreact
Adding guardrails to large language models.
★ 6,759Pythonupdated 2026-04-03aifoundation-modelgpt-3llmopenai
AppAgent: Multimodal Agents as Smartphone Users, an LLM-based multimodal agent framework designed to operate smartphone apps.
★ 6,683Pythonupdated 2025-03-19agentchatgptgenerative-aigpt4gpt4v
Deploy serverless AI workflows at scale. Firebase for AI agents
★ 6,603Jupyter Notebookupdated 2026-03-13agentsaiai-agentsai-agents-frameworkai-memory
Superagent protects your AI applications against prompt injections, data leaks, and harmful outputs. Embed safety directly into your app and prove compliance to your customers.
★ 6,556TypeScriptupdated 2026-04-11aianthropicguardrailsllmopenai
The Enterprise-Grade Production-Ready Multi-Agent Orchestration Framework. Website: https://swarms.ai
★ 6,543Pythonupdated 2026-04-20agentic-aiagentic-workflowagentsaiartificial-intelligence
A curated list of GPT agents for cybersecurity
★ 6,496updated 2024-07-21agentscybersecurityinfosecllm
WebChatGPT: A browser extension that augments your ChatGPT prompts with web results.
★ 6,457TypeScriptupdated 2024-08-13aibrowser-extensionchatgptchrome-extensionfirefox-addon
SuperPrompt is an attempt to engineer prompts that might help us understand AI agents.
★ 6,405updated 2025-09-03aimlprompt-engineeringpromptsprompts-template
An LLM playground you can run on your laptop
★ 6,357TypeScriptupdated 2026-02-06
Data processing for and with foundation models! 🍎 🍋 🌽 ➡️ ➡️🍸 🍹 🍷
★ 6,356Pythonupdated 2026-04-24datadata-analysisdata-pipelinedata-processingdata-science
Turn any webpage into structured data using LLMs
★ 6,351TypeScriptupdated 2026-04-13aiartificial-intelligencebrowserbrowser-automationgpt
Ship AI Agents to Google Cloud in minutes, not months. Production-ready templates with built-in CI/CD, evaluation, and observability.
★ 6,336Pythonupdated 2026-04-17agentsgcpgeminigenai-agentsgenerative-ai
Large Action Model framework to develop AI Web Agents
★ 6,326Pythonupdated 2025-01-21aibrowserlarge-action-modelllmoss
The agent-native LLM router for OpenClaw. 41+ models, <1ms routing, USDC payments on Base & Solana via x402.
★ 6,292TypeScriptupdated 2026-04-25aiai-agentsanthropiccost-optimizationdeepseek
The best agent harness.
★ 6,285Pythonupdated 2026-04-20agentic-codingai-workflowclaudecodecodexharness
Open-source context retrieval layer for AI agents
★ 6,260Pythonupdated 2026-04-20agent-infrastructureaiai-agentsai-infrastructureapi
An Open Source Python alternative to NotebookLM's podcast feature: Transforming Multimodal Content into Captivating Multilingual Audio Conversations with GenAI
★ 6,241Pythonupdated 2025-12-09elevenlabsgeminigenainotebooklmopenai
🤖 Awesome list for ChatGPT — an artificial intelligence chatbot developed by OpenAI
★ 6,215updated 2026-02-15aiartificial-intelligenceawesomeawesome-listchatgpt
YuE: Open Full-song Music Generation Foundation Model, something similar to Suno.ai but open
★ 6,167Pythonupdated 2025-06-04aiaudio-generationdeep-learningfoundation-modelsgpt
The first "code-first" agent framework for seamlessly planning and executing data analytics tasks.
★ 6,151Pythonupdated 2026-03-23agentai-agentscode-interpretercopilotdata-analysis
an ambient intelligence library
★ 6,144Pythonupdated 2026-04-17agentsaiambient-aichatbotsgpt
🔥 Official Firecrawl MCP Server - Adds powerful web scraping and search to Cursor, Claude and any other LLM clients.
★ 6,140JavaScriptupdated 2026-04-15batch-processingclaudecontent-extractiondata-collectionfirecrawl
Towards Human-Sounding Speech
★ 6,108Pythonupdated 2025-12-05llmrealtimetts
Aim 💫 — An easy-to-use & supercharged open-source experiment tracker.
★ 6,100Pythonupdated 2026-04-19aidata-sciencedata-visualizationexperiment-trackingmachine-learning
Collection of Open Source Projects Related to GPT,GPT相关开源项目合集🚀、精选🔥🔥
★ 6,000Pythonupdated 2025-05-16agentgptaiaigcautogptawesome
This is MCP server for Claude that gives it terminal control, file system search and diff file editing capabilities
★ 5,953TypeScriptupdated 2026-04-20agentaicode-analysiscode-generationgemini-cli-extension
Zero-Config Code Flow for Claude code & Codex
★ 5,944TypeScriptupdated 2026-04-02agentaiai-agentbmad-methodccr
TypeScript multi-agent orchestration engine — one runTeam() call from goal to result. Multi-model teams, auto task decomposition, parallel execution. 3 runtime dependencies.
★ 5,904TypeScriptupdated 2026-04-20agent-frameworkai-agentsanthropicclaudedeepseek
Collection of AI-related utilities. Welcome to submit pull requests /收藏AI相关的实用工具,欢迎提交pull requests
★ 5,856Pythonupdated 2026-04-20agent-skillsaiartificial-intelligenceawesomeawesome-list
Context-aware AI assistant for your desktop. Ready to respond intelligently, seamlessly integrating multiple LLMs and MCP tools.
★ 5,852C#updated 2026-04-19agentaiavaloniachatclaude
Transcribe on your own!
★ 5,849TypeScriptupdated 2026-04-19aicross-platformdesktopopenairust
Building AI agents, atomically
★ 5,846Pythonupdated 2026-04-18aiartificial-intelligencelarge-language-modellarge-language-modelsllms
This repository contains a hand-curated resources for Prompt Engineering with a focus on Generative Pre-trained Transformer (GPT), ChatGPT, PaLM etc
★ 5,820TypeScriptupdated 2026-04-20chatgptchatgpt-apideep-learningfew-shot-learninggpt
Python & Command-line tool to gather text and metadata on the Web: Crawling, scraping, extraction, output as CSV, JSON, HTML, MD, TXT, XML
★ 5,802Pythonupdated 2025-09-12article-extractorcorpus-buildercorpus-toolscrawlerhtml-to-markdown
🧠 Curated collection of system prompts for top AI tools. Perfect for AI agent builders and prompt engineers. Incuding: ChatGPT, Claude, Perplexity, Manus, Claude-Code, Loveable, v0, Grok, same new, windsurf, notion, and MetaAI.
★ 5,786TypeScriptupdated 2026-02-20
An awesome & curated list of best LLMOps tools for developers
★ 5,746Shellupdated 2026-04-06ai-development-toolsawesome-listllmopsmlops
🐬DeepChat - A smart assistant that connects powerful AI to your personal world
★ 5,738TypeScriptupdated 2026-04-20agentagent-skillsaiai-assistantai-sdk
A self-organizing file system with llama 3
★ 5,723TypeScriptupdated 2025-08-08
Klavis AI: MCP integration platforms that let AI agents use tools reliably at any scale
★ 5,718Pythonupdated 2026-04-20agentsaiai-agentsapideveloper-tools
A visual playground for agentic workflows: Iterate over your agents 10x faster
★ 5,713TypeScriptupdated 2025-07-20agentagentsaibuilderdeepseek
53AI Hub is an open-source AI portal, which enables you to quickly build a operational-level AI portal to launch and operate AI agents, prompts, and AI tools. It supports seamless integration with development platforms like Coze, Dify, FastGPT, RAGFlow.
★ 5,681Goupdated 2026-03-04cozedifyfastgptgomaxkb
Rules and Knowledge to work better with agents such as Claude Code or Cursor
★ 5,674Shellupdated 2025-12-31agentclaudecodecursorllmsrules
Real-time webcam demo with SmolVLM and llama.cpp server
★ 5,543HTMLupdated 2025-05-12
Automatic Speech Recognition with Speaker Diarization based on OpenAI Whisper
★ 5,502Jupyter Notebookupdated 2026-02-23asrspeaker-diarizationspeechspeech-recognitionspeech-to-text
Next-generation AI Agent Optimization Platform: Cozeloop addresses challenges in AI agent development by providing full-lifecycle management capabilities from development, debugging, and evaluation to monitoring.
★ 5,427Goupdated 2026-04-20agentagent-evaluationagent-observabilityagentopsai
The open source platform for AI-native application development.
★ 5,381Pythonupdated 2024-12-02agentaiai-nativefunction-callgenerative-ai
ZenML 🙏: One AI Platform from Pipelines to Agents. https://zenml.io.
★ 5,362Pythonupdated 2026-04-20agentopsagentsaiautomldata-science
A high-performance LLM inference API and Chat UI that integrates DeepSeek R1's CoT reasoning traces with Anthropic Claude models.
★ 5,361Rustupdated 2025-10-07aianthropicanthropic-claudeapichain-of-thought
Spec-driven development for large codebases
★ 5,351Pythonupdated 2026-04-20agentsai-agentsai-agents-frameworkartificial-intelligencedeveloper-tools
Free prompt engineering online course. ChatGPT and Midjourney tutorials are now included!
★ 5,318CSSupdated 2023-09-17promptprompt-engineeringprompt-toolkit
🐢 Open-Source Evaluation & Testing library for LLM Agents
★ 5,307Pythonupdated 2026-04-25agent-evaluationai-red-teamai-securityai-testingfairness-ai
MineContext is your proactive context-aware AI partner(Context-Engineering+ChatGPT Pulse)
★ 5,288Pythonupdated 2026-03-12agentcontext-engineeringelectronembedding-modelsjavascript
Langchain + Docker + Neo4j + Ollama
★ 5,285Pythonupdated 2026-03-30
Kodu is an autonomous coding agent that lives in your IDE. It is a VSCode extension that can help you build your dream project step by step by leveraging the latest technologies in automated coding agents
★ 5,277TypeScriptupdated 2025-04-30chatgptclaudecoding-agentsllmopenai
DeepSeek-VL2: Mixture-of-Experts Vision-Language Models for Advanced Multimodal Understanding
★ 5,274Pythonupdated 2025-02-26
Superduper: End-to-end framework for building custom AI applications and agents.
★ 5,271Pythonupdated 2025-09-01aichatbotdatadatabasedistributed-ml
5ire is a cross-platform desktop AI assistant, MCP client. It compatible with major service providers, supports local knowledge base and tools via model context protocol servers .
★ 5,180TypeScriptupdated 2026-03-18knowledge-basellmsmcpmcp-clientmodel-context-protocol
An AI-powered data science team of agents to help you perform common data science tasks 10X faster.
★ 5,178Pythonupdated 2026-01-28agentsaiai-engineerai-engineeringcopilot
Adversary simulation and Red teaming platform with AI
★ 5,033updated 2026-03-31agentaicobalt-strikellmmcp-server
🤖 AgentVerse 🪐 is designed to facilitate the deployment of multiple LLM-based agents in various applications, which primarily provides two frameworks: task-solving and simulation
★ 5,022JavaScriptupdated 2024-09-09agentaigptgpt-4llm
Perplexity Inspired Answer Engine
★ 5,021TypeScriptupdated 2025-06-27
A collection of prompts, system prompts and LLM instructions
★ 5,002HTMLupdated 2026-02-21
Kodezi Chronos is a debugging-first language model that achieves state-of-the-art results on SWE-bench Lite (80.33%) and 67% real-world fix accuracy, over six times better than GPT-4. Built with Adaptive Graph-Guided Retrieval and Persistent Debug Memory. Model available Q1 2026 via Kodezi OS.
★ 4,945Javaupdated 2025-11-12artificial-intelligenceautonomous-debuggingbenchmarkbenchmark-reportbug-fixing
Argilla is a collaboration tool for AI engineers and domain experts to build high-quality datasets
★ 4,945Pythonupdated 2026-04-13active-learningaiannotation-tooldeveloper-toolsgpt-4
A VSCode extension that allows you to use ChatGPT
★ 4,944TypeScriptupdated 2023-09-29
The open source research environment for AI researchers to seamlessly train, evaluate, and scale models from local hardware to GPU clusters.
★ 4,934Pythonupdated 2026-04-19diffusiondiffusion-modelselectronllamallms
This repo includes Claude prompt curation to use Claude better.
★ 4,932updated 2026-02-28anthropicanthropic-claudeawesome-claudeawesome-claude-promptsawesome-prompts
H2O LLM Studio - a framework and no-code GUI for fine-tuning LLMs. Documentation: https://docs.h2o.ai/h2o-llmstudio/
★ 4,914Pythonupdated 2026-04-08aichatbotchatgptfedrampfine-tuning
A GPU cluster manager that configures and orchestrates inference engines like vLLM and SGLang for high-performance AI model deployment.
★ 4,903Pythonupdated 2026-04-20ascendcudadeepseekdistributed-inferencegenai
Chat with your notes & see links to related content with AI embeddings. Use local models or 100+ via APIs like Claude, Gemini, ChatGPT & Llama 3
★ 4,901JavaScriptupdated 2026-04-18chatgptclaudeembeddingsgeminillama3
AI-Powered Dark Web OSINT Tool
★ 4,883Pythonupdated 2026-03-31ai-tooldarkwebdarkweb-osintinvestigation-toolllm-powered
A fast, helpful, and open-source document parser
★ 4,840TypeScriptupdated 2026-04-17document-ocrdocument-processingocrocr-recognitionpdf
A framework for serving and evaluating LLM routers - save LLM costs without compromising quality
★ 4,835Pythonupdated 2024-08-10
Magicrew. The first open-source all-in-one AI productivity platform (Generalist AI Agent + Workflow Engine + IM + Online collaborative office system)
★ 4,783TypeScriptupdated 2026-04-01agentagiaigptllm
Lord of Large Language and Multi modal Systems Web User Interface
★ 4,781Pythonupdated 2026-04-16aillmtext-generation
[COLM 2024] OpenAgents: An Open Platform for Language Agents in the Wild
★ 4,780Pythonupdated 2024-11-18agentassistant-chat-botscode-generationexecutable-langauge-groundinggpt
Dockerized FastAPI wrapper for Kokoro-82M text-to-speech model w/CPU ONNX and NVIDIA GPU PyTorch support, handling, and auto-stitching
★ 4,764Pythonupdated 2026-01-04fastapihuggingface-spaceskokorokokoro-ttsonnx
A lightweight next-gen data explorer - Postgres, MySQL, SQLite, MongoDB, Redis, MariaDB, Elastic Search, and Clickhouse with Chat interface
★ 4,759Goupdated 2026-04-23anthropicclickhousedata-analysisdata-visualizationdatabase
ACI.dev is the open source tool-calling platform that hooks up 600+ tools into any agentic IDE or custom AI agent through direct function calling or a unified MCP server. The birthplace of VibeOps.
★ 4,756Pythonupdated 2026-01-08agentsaiai-agentsapideveloper-tools
AutoRAG: An Open-Source Framework for Retrieval-Augmented Generation (RAG) Evaluation & Optimization with AutoML-Style Automation
★ 4,727Pythonupdated 2026-04-18analysisautomlbenchmarkingdocument-parserembeddings
Low-latency AI engine for mobile devices & wearables
★ 4,689Cupdated 2026-04-20aiandroidarmedgeedge-ai
Prompt Engineering, Generative AI, and LLM Guide by Learn Prompting | Join our discord for the largest Prompt Engineering learning community
★ 4,688MDXupdated 2025-01-14chatgptchatgpt-apideep-learninggpt-3gpt-4
UI over MCP. Create next-gen UI experiences with the protocol and SDK!
★ 4,685TypeScriptupdated 2026-03-12aifrontendllmmcpui
ByteRover CLI (brv) - The portable memory layer for autonomous coding agents (formerly Cipher)
★ 4,645TypeScriptupdated 2026-04-20agentaiautonomous-agentsclicoding-assistant
Prompt Engineering | Prompt Versioning | Use GPT or other prompt based models to get structured output. Join our discord for Prompt-Engineering, LLMs and other latest research
★ 4,588Pythonupdated 2026-03-27chatgptchatgpt-apichatgpt-pythongpt-3gpt-3-prompts
The first AI agent that builds permissionless integrations through reverse engineering platforms' internal APIs.
★ 4,575Pythonupdated 2026-04-15agentagentsai-agentai-agentsapi
Use any LLMs (Large Language Models) for Deep Research. Support SSE API and MCP server.
★ 4,568JavaScriptupdated 2026-04-14anthropicdeep-researchdeep-research-apideepresearchdeepseek
The open-source visual AI programming environment and TypeScript library
★ 4,545TypeScriptupdated 2026-03-20aillmopenaitypescript
A simple yet powerful agent framework that delivers with open-source models
★ 4,523Pythonupdated 2026-03-21agent-frameworkagentsopenai-agentspython
⚡️AI Cloud OS: Open-source enterprise-level AI knowledge base and MCP (model-context-protocol)/A2A (agent-to-agent) management platform with admin UI, user management and Single-Sign-On⚡️, supports ChatGPT, Claude, Llama, Ollama, HuggingFace, etc., chat bot demo: https://ai.casibase.com, admin UI demo: https://ai-admin.casibase.com
★ 4,503Goupdated 2026-04-26a2aagentagenticagentic-aiagi
🏝️ OASIS: Open Agent Social Interaction Simulations with One Million Agents.
★ 4,412Pythonupdated 2026-04-17agent-based-frameworkagent-based-simulationai-societiesdeep-learninglarge-language-models
RAG (Retrieval Augmented Generation) Framework for building modular, open source applications for production by TrueFoundry
★ 4,409Pythonupdated 2026-03-13agentaiapplicationdatadeep-learning
A fast multimodal LLM for real-time voice
★ 4,403Pythonupdated 2025-12-12aillmslmspeech
Local Deep Research achieves ~95% on SimpleQA benchmark (tested with GPT-4.1-mini). Supports local and cloud LLMs (Ollama, Google, Anthropic, ...). Searches 10+ sources - arXiv, PubMed, web, and your private documents. Everything Local & Encrypted.
★ 4,381Pythonupdated 2026-04-20academiaanthropicarxivbravedeep-research
GitHub Agentic Workflows
★ 4,370Goupdated 2026-04-20actionscaiciclaude-codecodex
Nexent is a zero-code platform for auto-generating production-grade AI agents using Harness Engineering principles — unified tools, skills, memory, and orchestration with built-in constraints, feedback loops, and control planes.
★ 4,360Pythonupdated 2026-04-20agentagentic-aiagentic-frameworkagentic-ragagentic-workflow
GLM-4.5: Agentic, Reasoning, and Coding (ARC) Foundation Models
★ 4,329Pythonupdated 2026-02-01agentglmllmmoereasoning-language-models
Preswald is a WASM packager for Python-based interactive data apps: bundle full complex data workflows, particularly visualizations, into single files, runnable completely in-browser, using Pyodide, DuckDB, Pandas, and Plotly, Matplotlib, etc. Build dashboards, reports, and notebooks that run offline, load fast, and share like a document.
★ 4,286Pythonupdated 2026-04-14aianalyticsanalytics-engineeringcopilotdata
Your agent in your terminal, equipped with local tools: writes code, uses the terminal, browses the web. Make your own persistent autonomous agent on top!
★ 4,280Pythonupdated 2026-04-20agentagentsai-agentsai-assistantanthropic
Mac app for crushing tech interviews with AI
★ 4,263Swiftupdated 2025-01-14aichatgptgptgpt-4openai
The most powerful AI agent and AI chat software on Android/Operit是一款Android上能力最为强大的AI Agent
★ 4,249Kotlinupdated 2026-04-20agentaiandroidcomposekotlin
Build, evaluate, and integrate long-term memory for self-evolving agents.
★ 4,212Pythonupdated 2026-04-20agent-memoryagentic-aiaichatsclawdbot
Learn Agentic AI using Dapr Agentic Cloud Ascent (DACA) Design Pattern and Agent-Native Cloud Technologies: OpenAI Agents SDK, Memory, MCP, A2A, Knowledge Graphs, Dapr, Rancher Desktop, and Kubernetes.
★ 4,097Jupyter Notebookupdated 2025-10-26a2aagentic-aidaprdapr-pub-subdapr-service-invocation
DeepSeek-VL: Towards Real-World Vision-Language Understanding
★ 4,091Pythonupdated 2024-04-24foundation-modelsvision-language-modelvision-language-pretraining
DeepAnalyze is the first agentic LLM for autonomous data science. 🎈你的AI数据分析师,自动分析大量数据,一键生成专业分析报告!
★ 4,087Pythonupdated 2026-04-13agentagenticagentic-aiaiai-scientist
Open-source evaluation toolkit of large multi-modality models (LMMs), support 220+ LMMs, 80+ benchmarks
★ 4,079Pythonupdated 2026-04-10chatgptclaudeclipcomputer-visionevaluation
One-for-All Multimodal Evaluation Toolkit Across Text, Image, Video, and Audio Tasks
★ 4,063Pythonupdated 2026-04-20agiaudio-evaluationbenchmarkevaluationlarge-language-models
The open-source LLMOps platform: prompt playground, prompt management, LLM evaluation, and LLM observability all in one place.
★ 4,060TypeScriptupdated 2026-04-20agentsevaluationllm-as-a-judgellm-evaluationllm-framework
Local persistent memory store for LLM applications including claude desktop, github copilot, codex, antigravity, etc.
★ 4,020TypeScriptupdated 2026-04-19aiai-agentsai-infrastructureai-memoryartificial-intelligence
🤖 A visualization mcp & skills contains 25+ visual charts using @antvis. Using for chart generation and data analysis.
★ 4,016TypeScriptupdated 2026-02-25antvllmmcpmcp-serverskills
Harness LLMs with Multi-Agent Programming
★ 3,985Pythonupdated 2026-04-07agentsaichatgptfunction-callinggpt
A nearly-live implementation of OpenAI's Whisper.
★ 3,984Pythonupdated 2026-04-16dictationobsopenaiopenvinoopenvino-intel
Every front-end GUI client for ChatGPT, Claude, and other LLMs
★ 3,975updated 2026-01-22anthropicchatgptclaudegpt-3gpt-4
Examples and tutorials to help developers build AI systems
★ 3,963Pythonupdated 2026-03-05agentsaianthropicllmopenai
Latitude is the open-source agent engineering platform
★ 3,963TypeScriptupdated 2026-04-20
Like Manus, Computer Use Agent(CUA) and Omniparser, we are computer-using agents.AI-driven local automation assistant that uses natural language to make computers work by themselves
★ 3,903Pythonupdated 2026-04-13agentaicomputerusedeepseekmanus
Claudable is an open-source web builder that leverages local CLI agents, such as Claude Code, Codex, Gemini CLI, Qwen Code, and Cursor Agent, to build and deploy products effortlessly.
★ 3,902TypeScriptupdated 2026-04-11agentclaudeclaude-codecodexcodingagent
ChatGPT Jailbreaks, GPT Assistants Prompt Leaks, GPTs Prompt Injection, LLM Prompt Security, Super Prompts, Prompt Hack, Prompt Security, Ai Prompt Engineering, Adversarial Machine Learning.
★ 3,864HTMLupdated 2026-03-06adversarial-machine-learningagentaiassistantchatgpt
TimeGPT-1: production ready pre-trained Time Series Foundation Model for forecasting and anomaly detection. Generative pretrained transformer for time series trained on over 100B data points. It's capable of accurately predicting various domains such as retail, electricity, finance, and IoT with just a few lines of code 🚀.
★ 3,861Jupyter Notebookupdated 2026-04-13agentagentic-aianomaly-detectionartificial-intelligencedeep-learning
Claraverse is a opesource privacy focused ecosystem to replace ChatGPT, Claude, N8N, ImageGen with your own hosted llm, keys and compute. With desktop, IOS, Android Apps.
★ 3,800Goupdated 2026-03-01hacktoberfestllmollamaopensourcellmswebui
🤖 Build voice-based LLM agents. Modular + open source.
★ 3,731Pythonupdated 2024-11-15
Qwen3-omni is a natively end-to-end, omni-modal LLM developed by the Qwen team at Alibaba Cloud, capable of understanding text, audio, images, and video, as well as generating speech in real time.
★ 3,705Jupyter Notebookupdated 2026-01-08
Lemonade helps users discover and run local AI apps by serving optimized LLMs right from their own GPUs and NPUs. Join our discord: https://discord.gg/5xXzkMu8Zk
★ 3,676C++updated 2026-04-19aiamdgenaigpullama
The media player for language learning, with dual subtitles, AI-generated subtitles, real-time translation, and more!
★ 3,657C#updated 2026-04-19asrcsharpflyleaflanguage-learningllm
An AI Gateway, registry, and proxy that sits in front of any MCP, A2A, or REST/gRPC APIs, exposing a unified endpoint with centralized discovery, guardrails and management. Optimizes Agent & Tool calling, and supports plugins.
★ 3,616Pythonupdated 2026-04-20agentsaiapi-gatewayasyncioauthentication-middleware
Enterprise AI Platform with guardrails, MCP registry, gateway & orchestrator
★ 3,600TypeScriptupdated 2026-04-20a2aa2a-mcpacpagentai
Fully customizable AI chatbot component for your website
★ 3,589TypeScriptupdated 2026-04-19aiai-chatbotchatchatbotchatgpt
An open source implementation of OpenAI's ChatGPT Code interpreter
★ 3,557Pythonupdated 2024-03-20chatgptgptllmsopenai
Universal memory layer for AI Agents. It provides scalable, extensible, and interoperable memory storage and retrieval to streamline AI agent state management for next-generation autonomous systems.
★ 3,535Pythonupdated 2026-04-17agentagentic-aiagentsagents-sdkai
🔍 AI search engine - self-host with local or cloud LLMs
★ 3,530TypeScriptupdated 2024-09-27fastapigenerative-uigpt-4ogroqllm
⌥ AI Coding agent for the terminal — hash-anchored edits, optimized tool harness, LSP, Python, browser, subagents, and more
★ 3,508TypeScriptupdated 2026-04-18ai-agentai-coding-agentanthropicbunclaude
Run Claude Code on OpenAI models
★ 3,484Pythonupdated 2025-11-19
🤖 A Telegram bot that integrates with OpenAI's official ChatGPT APIs to provide answers, written in Python
★ 3,451Pythonupdated 2025-06-03chatgptdall-eopenaipythontelegram-bot
Semi-automated research assistant for academic research and software development. Supports Claude Code, OpenCode, and Codex CLI across ideation, coding, experiments, writing, and publication.
★ 3,447Pythonupdated 2026-04-15academic-researchai-agentsclaudeclaude-codecodex-cli
OpenClaw for Teams
★ 3,381Pythonupdated 2026-04-20agentllmmultiagentopenclaw
A Comprehensive Benchmark to Evaluate LLMs as Agents (ICLR'24)
★ 3,361Pythonupdated 2026-02-08chatgptgpt-4llmllm-agent
Agent Skills as a Memory Layer
★ 3,346JavaScriptupdated 2026-04-15agentagent-development-kitagent-observabilityai-agentanthropic
II-Agent: a new open-source framework to build and deploy intelligent agents
★ 3,330Pythonupdated 2026-04-13agentagentic-aiaiai-agentai-agent-framework
Skills for the Gemini API, SDK and model/agent interactions
★ 3,318updated 2026-03-27geminigemini-apiskills
[TMLR] A curated list of language modeling researches for code (and other software engineering activities), plus related datasets.
★ 3,312updated 2026-04-10aiawesomedatasetsllmnlp
OpenAgents - AI Agent Networks for Open Collaboration
★ 3,307Pythonupdated 2026-04-20agentsaicollaborationllmnetwork
🤖 Telegram Bot API PHP SDK. Lets you build Telegram Bots easily! Supports Laravel out of the box.
★ 3,289PHPupdated 2026-04-01botbot-frameworkbotkitchatbotcomposer-packages
Open-source Claude Design alternative. One-click import your Claude Code / Codex API key. Prompt → prototype / slides / PDF. Multi-model (Claude, GPT, Gemini, Kimi, GLM, Ollama). BYOK, local-first, MIT.
★ 3,281TypeScriptupdated 2026-04-24ai-designanthropicbyokclaudeclaude-code
Evaluation and Tracking for LLM Experiments and AI Agents
★ 3,269Pythonupdated 2026-04-20agent-evaluationagentopsai-agentsai-monitoringai-observability
Instantly generate AI-powered subtitles on your device. Works standalone or connects to DaVinci Resolve.
★ 3,269TypeScriptupdated 2026-04-19aidavincidavinci-resolvediarizelinux
🌊 AChat - An open-source/self-hosted/local-first AI platform, designed for enterprises and teams, perfectly combining powerful local processing capabilities with seamless remote synchronization.
★ 3,257TypeScriptupdated 2026-04-17agentaichatchatbotclaude
Automatic Generation of Visualizations and Infographics using Large Language Models
★ 3,248Jupyter Notebookupdated 2024-08-08coheredatavisualizationhacktoberfestllmopenai
World's first open-source, agentic video production system. 12 pipelines, 52 tools, 500+ agent skills. Turn your AI coding assistant into a full video production studio.
★ 3,247Pythonupdated 2026-04-24agentagentic-aiaiclaudecopilot
🕹️ Open-source, developer-first LLMOps platform designed to streamline prompt design, version management, instant delivery, collaboration, troubleshooting, observability and more.
★ 3,228TypeScriptupdated 2026-03-31aidevtoolsgpt-3gpt-4hacktoberfest
The platform for LLM evaluations and AI agent testing
★ 3,224TypeScriptupdated 2026-04-20aianalyticsdatasetsdspyevaluation
Build production-ready AI agents in both Python and Typescript.
★ 3,224Pythonupdated 2026-04-08agentsaiai-agentbeeaiframework
Code for the paper "Evaluating Large Language Models Trained on Code"
★ 3,212Pythonupdated 2025-01-17
Turn approved specs into long-running autonomous implementation. A minimal, adaptable SDD harness with Agent Skills for Claude Code, Codex, Cursor, Copilot, Windsurf, OpenCode, Gemini CLI, and Antigravity.
★ 3,200TypeScriptupdated 2026-04-14agent-skillsclaude-codecodexcursorgemini-cli
The missing DevTools for Claude Code — inspect session logs, tool calls, token usage, subagents, and context window in a visual UI. Free, open source.
★ 3,192TypeScriptupdated 2026-04-18aiai-agentai-debuggingai-toolsanthropic
All Cursor AI's official download links for both the latest and older versions, making it easy for you to update, downgrade, and choose any version. 🚀
★ 3,187TypeScriptupdated 2026-04-20curosrcursorcursor-aicursor-ai-editorcursor-ide
An AI-powered file management tool that ensures privacy by organizing local texts, images. Using Llama3.2 3B and Llava v1.6 models with the Nexa SDK, it intuitively scans, restructures, and organizes files for quick, seamless access and easy retrieval.
★ 3,186Pythonupdated 2024-10-21file-organizerllama3llmon-device-aivlm
AGiXT is a dynamic AI Agent Automation Platform that seamlessly orchestrates instruction management and complex task execution across diverse AI providers. Combining adaptive memory, smart features, and a versatile plugin system, AGiXT delivers efficient and comprehensive AI solutions.
★ 3,180Pythonupdated 2026-04-20agent-llmagiagixtaiartificial
LSP-AI is an open-source language server that serves as a backend for AI-powered functionality, designed to assist and empower software engineers, not replace them.
★ 3,162Rustupdated 2025-01-07aiauto-completiondeveloper-toolsidelanguage-client
AI Chatbots in terminal for free
★ 3,143Goupdated 2026-03-14aichatbotchatgptcligo
162 production-ready AI agent templates for OpenClaw. SOUL.md configs across 19 categories. Submit yours!
★ 3,104HTMLupdated 2026-04-13ai-agent-templatesai-agentsai-automationanthropicautomation
Multi-modal Generative Media Skills for AI Agents (Claude Code, Cursor, Gemini CLI). High-quality image, video, and audio generation powered by muapi.ai.
★ 3,099Shellupdated 2026-04-13agent-toolsai-agentsai-artai-musicai-video
A single Gradio + React WebUI with extensions for ACE-Step, OmniVoice, Kimi Audio, Piper TTS, GPT-SoVITS, CosyVoice, XTTSv2, DIA, Kokoro, OpenVoice, ParlerTTS, Stable Audio, MMS, StyleTTS2, MAGNet, AudioGen, MusicGen, Tortoise, RVC, Vocos, Demucs, SeamlessM4T, and Bark!
★ 3,094TypeScriptupdated 2026-04-19ace-stepaiaudio-generationcosyvoicegenerative-ai
🔥 Comprehensive survey on Context Engineering: from prompt engineering to production-grade AI systems. hundreds of papers, frameworks, and implementation guides for LLMs and AI agents.
★ 3,085updated 2026-03-10agentagentic-aiagiawesome-listcognitive-science
(Crystal is now Nimbalyst) Run multiple Codex and Claude Code AI sessions in parallel git worktrees. Test, compare approaches & manage AI-assisted development workflows in one desktop app.
★ 3,034TypeScriptupdated 2026-02-26agentic-aiaiai-codinganthropicclaude
AI agent microservice
★ 3,034Pythonupdated 2026-03-14ag-ui-protocolagentaiassistantchatbot
🤖 Assemble, configure, and deploy autonomous AI Agents in your browser.一键免费部署你的私人AutoGPT 网页应用
★ 3,006TypeScriptupdated 2025-02-10auto-gptconnect-aidockerdocker-composelangchangjs
Must-read Papers on LLM Agents.
★ 2,984updated 2026-04-17agentagentsawsome-listenvironmentin-context-learning
An open-source visual programming environment for battle-testing prompts to LLMs.
★ 2,975TypeScriptupdated 2026-04-06aievaluationlarge-language-modelsllmopsllms
A python program that turns an LLM, running on Ollama, into an automated researcher, which will with a single query determine focus areas to investigate, do websearches and scrape content from various relevant websites and do research for you all on its own! And more, not limited to but including saving the findings for you!
★ 2,966Pythonupdated 2024-12-14
The no-code platform for building custom LLM Agents
★ 2,940updated 2024-06-17aiaichatbotchatbotchatbotschatgpt
🏆 Top-1 on 5+ benchmarks | Web UI | Supports MiroThinker, Claude, Kimi, OpenAI
★ 2,938Pythonupdated 2026-04-09agent-frameworkagentsbrowsecompclaudedeep-research
Real time transcription with OpenAI Whisper.
★ 2,926Pythonupdated 2025-04-15
AI conversations that actually remember. Never re-explain your project to your AI again. Join our Discord: https://discord.gg/tyvKNccgqN
★ 2,925Pythonupdated 2026-04-20aiclaudeknowledge-managementknowlege-graphllm
🚀 EvoAgentX: Building a Self-Evolving Ecosystem of AI Agents
★ 2,897Pythonupdated 2026-04-17agentaiai-agentsllmsmemory
One command brings a complete pre-wired LLM stack with hundreds of services to explore.
★ 2,871TypeScriptupdated 2026-04-16aiautomationbashclicontainer
o1-engineer is a command-line tool designed to assist developers in managing and interacting with their projects efficiently. Leveraging the power of OpenAI's API, this tool provides functionalities such as code generation, file editing, and project planning to streamline your development workflow.
★ 2,854Pythonupdated 2024-12-16
Put up to 8 AI models on every coding task — blind spots surface before you ship. Claude Code plugin.
★ 2,844Shellupdated 2026-04-20ai-agentsai-orchestrationclaude-codeclaude-code-plugincodex
Laminar - open-source observability platform purpose-built for AI agents. YC S24.
★ 2,803TypeScriptupdated 2026-04-20agent-observabilityagentsaiai-observabilityaiops
Unleash Next-Level AI! 🚀 💻 Code Generation: DeepSeek r1 + Claude 3.7 Sonnet - Unparalleled Performance! 📝 Content Creation: DeepSeek r1 + Gemini 2.5 Pro - Superior Quality! 🔌 OpenAI-Compatible. 🌊 Streaming & Non-Streaming Support. ✨ Experience the Future of AI – Today! Click to Try Now! ✨
★ 2,790Pythonupdated 2026-02-23aiclaude-3-7-sonnetdeepseekgemini
🦜💬 Web app for interacting with any LangGraph agent (PY & TS) via a chat interface.
★ 2,778TypeScriptupdated 2026-04-13agentchatlanggraphllm
ALLWEONE® Open source AI presentation generator Gamma Alternative. Create professional slides with customizable themes and AI-generated content in minutes.
★ 2,768TypeScriptupdated 2026-04-04aiall-in-oneallweonegammagenerative-ai
An improved implementation of the Ralph Wiggum technique for autonomous AI agent orchestration
★ 2,759Rustupdated 2026-04-18aiai-agentsai-agents-frameworkai-developer-toolsclaude-code
Data context layer for unstructured data - images, video, sensor data, text and PDFs
★ 2,737Pythonupdated 2026-04-20claude-codecodexdata-context-layerdata-processingharness
A portable open-source operating system for agents. ~6 ms coldstarts, 32x cheaper than sandboxes. Powered by WebAssembly and V8 isolates.
★ 2,734Rustupdated 2026-04-14agentaijavascriptllmsandbox
A streamlined and customizable framework for efficient large model (LLM, VLM, AIGC) evaluation and performance benchmarking.
★ 2,723Pythonupdated 2026-04-20evaluationllmperformanceragvlm
RAG on Paul Graham's essays.
★ 2,670TypeScriptupdated 2023-07-28
Ruler — apply the same rules to all coding agents
★ 2,663TypeScriptupdated 2026-04-15agentsaiaiderclaude-codecodex
Learn to build your Second Brain AI assistant with LLMs, agents, RAG, fine-tuning, LLMOps and AI systems techniques.
★ 2,663Jupyter Notebookupdated 2026-04-06agentsai-systemsdata-engineeringfine-tuninghuggingface
Control Any Computer Using LLMs.
★ 2,659Pythonupdated 2026-02-25assistantassistant-computer-controlautomationgptgpt4
My own Prompts for Custom instructions ChatGPT
★ 2,654updated 2026-03-14
All-in-one platform for search, recommendations, RAG, and analytics offered via API
★ 2,641Rustupdated 2026-01-25actixactix-webaiartificial-intelligencediesel
[EMNLP-2024] Build multimodal language agents for fast prototype and production
★ 2,640Pythonupdated 2025-03-19agentchatbotgeminigptgpt4
Multi-agent orchestration workflow (Claude Code Codex Gemini OpenCode)
★ 2,620Goupdated 2026-04-09
A react-based starter app for using the Live API over websockets with Gemini
★ 2,530TypeScriptupdated 2026-04-15geminigemini-api
Modular Python framework for AI agents and workflows with chain-of-thought reasoning, tools, and memory.
★ 2,523Pythonupdated 2026-04-17aianthropicclaudegpthuggingface
Large language models (LLMs) made easy, EasyLM is a one stop solution for pre-training, finetuning, evaluating and serving LLMs in JAX/Flax.
★ 2,520Pythonupdated 2024-08-13chatbotdeep-learningflaxjaxlanguage-model
CodeMachine is an open-source tool that orchestrates AI coding agents into repeatable, long-running workflows. ⚡️
★ 2,447TypeScriptupdated 2026-02-25aiautomationclicli-toolcode-generation
✨ Fully autonomous AI Agent that can perform complicated tasks and projects using terminal, browser, and editor.
★ 2,445TypeScriptupdated 2024-04-29agentaiautonomous-agentsbotdevin
Brings MCP to ChatGPT, DeepSeek, Perplexity, Grok, Gemini, Google AI Studio, OpenRouter, DeepSeek, T3 Chat and more...
★ 2,435TypeScriptupdated 2026-02-09aistudioassistantchatgptdeepseekgemini
Official Code of Memento: Fine-tuning LLM Agents without Fine-tuning LLMs
★ 2,409Pythonupdated 2025-10-05
Open source platform for AI Engineering: OpenTelemetry-native LLM Observability, GPU Monitoring, Guardrails, Evaluations, Prompt Management, Vault, Playground. 🚀💻 Integrates with 50+ LLM Providers, VectorDBs, Agent Frameworks and GPUs.
★ 2,400TypeScriptupdated 2026-04-20ai-observabilityamd-gpuclickhousedistributed-tracinggenai
Export and Share your ChatGPT conversation history
★ 2,391TypeScriptupdated 2026-03-01aichatgptexportermarkdowntampermonkey
OpenAPI specification for the OpenAI API
★ 2,367updated 2025-06-17openaiopenai-api
the terminal client for Ollama
★ 2,360Pythonupdated 2025-12-19llmllmsmachine-learningollamapython
A Tool to Visualize Claude Code's LLM Interactions
★ 2,356JavaScriptupdated 2025-08-26
Pipelines: Versatile, UI-Agnostic OpenAI-Compatible Plugin Framework
★ 2,354Pythonupdated 2025-08-18open-webui
Real-time multi-AI collaboration: Claude, Codex & Gemini with persistent context, minimal token overhead
★ 2,351Pythonupdated 2026-04-18ai-collaborationai-toolsclaude-codeclicodex
extendable code review and QA agent 🚢
★ 2,351TypeScriptupdated 2025-11-24agentagentscicdcode-qualitycode-review
Research into how agentic AI coding assistants work — reconstructed prompt patterns, agent coordination, and security classification
★ 2,349updated 2026-03-31agentic-aiai-researchclaudeprompt-engineeringsystem-prompts
Bridge Claude Code / Codex to IM platforms — chat with AI coding agents from Telegram, Discord, or Feishu/Lark.
★ 2,344TypeScriptupdated 2026-03-23chatbotclaudeclaude-codediscordfeishu
UpTrain is an open-source unified platform to evaluate and improve Generative AI applications. We provide grades for 20+ preconfigured checks (covering language, code, embedding use-cases), perform root cause analysis on failure cases and give insights on how to resolve them.
★ 2,344Pythonupdated 2024-08-18autoevaluationevaluationexperimentationhallucination-detectionjailbreak-detection
No-code multi-agent framework to build LLM Agents, workflows and applications with your data
★ 2,291Pythonupdated 2024-12-11agentsaiai-agents-frameworkgenerative-aillm-agents
This SDK is now deprecated, use the new unified Google GenAI SDK.
★ 2,289Pythonupdated 2025-12-16
A repo lists papers related to LLM based agent
★ 2,285Pythonupdated 2025-07-12agentslarge-language-modelsllm-agentpaper-list
🔊 Awesome list for Whisper — an open-source AI-powered speech recognition system developed by OpenAI
★ 2,275updated 2026-03-17aiartificial-intelligenceawesomeawesome-listgpt
A Lightweight LLM Post-Training Library
★ 2,242Pythonupdated 2026-04-19
A lightweight framework for building LLM-based agents
★ 2,242Pythonupdated 2026-04-20agentgptllmtransformers
Comprehensive resources on Generative AI, including a detailed roadmap, projects, use cases, interview preparation, and coding preparation.
★ 2,239Jupyter Notebookupdated 2026-04-18agentic-aiagentic-frameworkclaudegeminigenai
Awesome resources for in-context learning and prompt engineering: Mastery of the LLMs such as ChatGPT, GPT-3, and FlanT5, with up-to-date and cutting-edge updates.
★ 2,228Jupyter Notebookupdated 2026-04-02ai-agentchain-of-thoughtchatbotchatgptchatgpt-api
Awesome things about LLM-powered agents. Papers / Repos / Blogs / ...
★ 2,226updated 2025-04-30awesome-listchatgptembodied-agentembodied-aifoundation-model
The universal tool suite for vector database management. Manage Pinecone, Chroma, Qdrant, Weaviate and more vector databases with ease.
★ 2,213TypeScriptupdated 2025-04-15aiai-agentsaitoolschromadatabase-management
agentUniverse is a LLM multi-agent framework that allows developers to easily build multi-agent applications.
★ 2,212Pythonupdated 2026-04-01agentaiai-agentsautonomousawesome
Control Gmail, Google Calendar, Docs, Sheets, Slides, Chat, Forms, Tasks, Search & Drive with AI - Comprehensive Google Workspace / G Suite MCP Server & CLI Tool
★ 2,211Pythonupdated 2026-04-17aig-suitegmailgoogle-calendargoogle-chat
The world's smartest system-wide grammar assistant; a better version of the Apple Intelligence Writing Tools. Works on Windows, Linux, & macOS, with the free Gemini API, local LLMs, & more.
★ 2,209Swiftupdated 2026-03-01aiartificial-intelligencegeminigrammar-checkerlargelanguagemodel
Automatically generate and overlay subtitles for any video.
★ 2,203Pythonupdated 2024-07-12ffmpegopenai-whispersubtitle-generatorsubtitlessubtitles-generator
Terminal session manager for AI coding agents. One TUI for Claude, Gemini, OpenCode, Codex, and more.
★ 2,182Goupdated 2026-04-20ai-agentai-agentsai-coding-assistantaiderbubble-tea
🧠 Make your agents learn from experience. Now available as a hosted solution at kayba.ai
★ 2,176Pythonupdated 2026-04-25agent-learningagent-memoryagentsaiai-agents
(Supports DeepSeek R1) An AI-powered research assistant that performs iterative, deep research on any topic by combining search engines, web scraping, and large language models.
★ 2,176TypeScriptupdated 2025-08-19agentaifreegptnuxt
PentestAgent is an AI agent framework for black-box security testing, supporting bug bounty, red-team, and penetration testing workflows.
★ 2,136Pythonupdated 2026-04-12aiai-agentsai-assistantai-cybersecurityai-hacking
Open-source AI-driven quantitative trading platform for crypto, stocks, and forex with backtesting, live trading, market data, and multi-agent research.
★ 2,135Pythonupdated 2026-04-20ai-traderalgorithmic-trading-portfolioalgotradebacktesting-frameworkscryptocurrencies
Open source alternative to Gemini Deep Research. Generate reports with AI based on search results.
★ 2,131TypeScriptupdated 2025-12-15
Your Automatic Prompt Engineering Assistant for GenAI Applications
★ 2,127Pythonupdated 2024-04-22aiai-experimentsai-toolkitaigcapi
Replace Copilot local AI
★ 2,083TypeScriptupdated 2024-05-13
AI coding workstation: Claude Code + web UI + 7 AI CLIs + headless browser + 50+ tools
★ 2,068Dockerfileupdated 2026-04-10aiai-codinganthropicclaudeclaude-code
Whisper as a Service (GUI and API with queuing for OpenAI Whisper)
★ 2,066JavaScriptupdated 2026-04-17
Perplexity style AI Search engine clone built with Gemini 2.0 Flash and Grounding
★ 2,065TypeScriptupdated 2025-01-04
An Obsidian vault that gives AI coding agents persistent memory. Claude Code, Codex CLI, Gemini CLI.
★ 2,061TypeScriptupdated 2026-04-19
Completely free, private, UI based Tech Documentation MCP server. Designed for coders and software developers in mind. Easily integrate into Cursor, Windsurf, Cline, Roo Code, Claude Desktop App
★ 2,058TypeScriptupdated 2026-02-04clinecrawl4aicursordocumentationllm
423 plugins, 2,849 skills, 177 agents for Claude Code. Open-source marketplace at tonsofskills.com with the ccpi CLI package manager.
★ 2,032Pythonupdated 2026-04-19agent-skillsaiai-agentsanthropicautomation
Offline multi-agent simulation & prediction engine. English fork of MiroFish with Neo4j + Ollama local stack.
★ 2,024Pythonupdated 2026-03-24aimulti-agentneo4jofflineollama
OpenDAN is an open source Personal AI OS , which consolidates various AI modules in one place for your personal use.
★ 2,022Pythonupdated 2026-03-28agentaiautogptllmopenai
Run AI models locally on your machine with node.js bindings for llama.cpp. Enforce a JSON schema on the model output on the generation level
★ 2,019TypeScriptupdated 2026-04-12aibindingscataicmakecmake-js
ChatGPT web interface using the OpenAI API
★ 1,984Svelteupdated 2026-04-20
Build applications that make decisions (chatbots, agents, simulations, etc...). Monitor, trace, persist, and execute on your own infrastructure.
★ 1,978Pythonupdated 2026-04-19aiburrchatbot-frameworkdagsgenerative-ai
An automatic evaluator for instruction-following language models. Human-validated, high-quality, cheap, and fast.
★ 1,977Jupyter Notebookupdated 2025-08-09deep-learningevaluationfoundation-modelsinstruction-followinglarge-language-models
AI computer use powered by open source LLMs and E2B Desktop Sandbox
★ 1,977Pythonupdated 2025-06-05agentaianthropicclaudecomputer-use
A Unified MCP Server Management App (MCP Manager).
★ 1,976TypeScriptupdated 2026-01-24llmllmopsmcpmcp-clientmcp-manager
📰 Must-read papers and blogs on LLM based Long Context Modeling 🔥
★ 1,974updated 2026-04-15agentawsome-listbenchmarkblogscompress
OpenAI Assistants API quickstart with Next.js.
★ 1,965TypeScriptupdated 2025-03-07
Witsy: desktop AI assistant / universal MCP client
★ 1,948TypeScriptupdated 2026-04-09anthropicdeepseekelectron-appelectronjsgemini
🌸 Best framework to build web agents, and deploy serverless web automation functions on reliable browser infra.
★ 1,939Pythonupdated 2026-04-17agentaianthropicautomationbrowser
Text Generator is a versatile plugin for Obsidian that allows you to generate text content using various AI providers, including OpenAI, Anthropic, Google and local models.
★ 1,918TypeScriptupdated 2026-04-08aichatgptgpt-3gpt-4huggingface
JSON-driven multi-agent cadence-team development framework with intelligent CLI orchestration (Gemini/Qwen/Codex), context-first architecture, and automated workflow execution
★ 1,898TypeScriptupdated 2026-04-19claudeclaude-codecli-toolscodexcontext-management
Ui.Vision Open-Source RPA Software with Computer Vision, OCR, Anthropic Computer Use/LLM. Selenium IDE import/export.
★ 1,891JavaScriptupdated 2026-03-20anthropicanthropic-claudebrowser-automationbrowser-extensioncomputer-use
Development platform to debug, chat, inspect, and evaluate MCP servers, MCP apps, and ChatGPT apps.
★ 1,888TypeScriptupdated 2026-04-20anthropicchatgptcicddebuggerevals
The leading open-source AI copilot for JetBrains. Connect to any model in any environment, and customize your coding experience in any way you like.
★ 1,888Kotlinupdated 2026-04-20codellamagpt-4intellijintellij-pluginjetbrains
GPT-5 coding examples
★ 1,877HTMLupdated 2025-12-11codexcodingfrontendgptopenai
AutoChain: Build lightweight, extensible, and testable LLM Agents
★ 1,877Pythonupdated 2025-12-16
Cutting edge AI technology for automated audio transcription. A nice GUI for OpenAIs Whisper and pyannote (speaker identification)
★ 1,876Pythonupdated 2026-04-17audio-transcriptionfaster-whisperinterviewpyannotequalitative-research
The PHP Agentic Framework to build production-ready AI driven applications. Connect components (LLMs, vector DBs, memory) to agents that can interact with your data.
★ 1,870PHPupdated 2026-04-20agentagentic-aiagentic-frameworkagentsai
[ICLR 2025] LongWriter: Unleashing 10,000+ Word Generation from Long Context LLMs
★ 1,857Pythonupdated 2025-06-24fine-tuningllmlong-contextlong-text
ContextGem: Effortless LLM extraction from documents
★ 1,823Pythonupdated 2026-03-16aicontract-analysisdata-extractiondocument-intelligencedocx
AI as Workspace - An elegant AI chat client. Full-featured, lightweight. Support multiple workspaces, plugin system, cross-platform, local first + real-time cloud sync, Artifacts, MCP | 更好的 AI 客户端
★ 1,801TypeScriptupdated 2026-04-15aichatgptclaudecross-platformdocker
收集GPTS的prompt / Collect the prompt of GPTS
★ 1,784updated 2025-12-24chatgptchatgpt-apigptsgptslistprompt
Dive is an open-source MCP Host Desktop Application that seamlessly integrates with any LLMs supporting function calling capabilities. ✨
★ 1,779TypeScriptupdated 2026-04-01aiai-agentsllm-interfacellm-uimcp-client
Run Claude Code, Gemini, Codex — or any coding agent — in a clean, isolated sandbox with sensitive data redaction and observability baked in.
★ 1,772TypeScriptupdated 2026-01-13agentaiclaude-codecodexgemini-cli
A beautiful local-first coding agent running in your terminal - built by the community for the community ⚒
★ 1,767TypeScriptupdated 2026-04-20aiai-agentsai-codingcoding-agentsllm
LocalAGI is a powerful, self-hostable AI Agent platform designed for maximum privacy and flexibility. A complete drop-in replacement for OpenAI's Responses APIs with advanced agentic capabilities. No clouds. Local AI that works on consumer-grade hardware (CPU and GPU).
★ 1,761Goupdated 2026-04-15
Desktop AI Assistant powered by GPT-5, GPT-4, o1, o3, Gemini, Claude, Ollama, DeepSeek, Perplexity, Grok, Bielik, chat, vision, voice, RAG, image and video generation, agents, tools, MCP, plugins, speech synthesis and recognition, web search, memory, presets, assistants,and more. Linux, Windows, Mac
★ 1,749Pythonupdated 2026-02-06aiai-assistantartificial-intelligenceautonomous-agentchatbot
Practical productivity tools for Claude Code, Codex-CLI, and similar CLI coding agents.
★ 1,744Pythonupdated 2026-04-19claude-codeclicli-agentcode-agentcodex
An AutoGPT agent that controls Chrome on your desktop
★ 1,742Pythonupdated 2023-10-25aiautogptchatgptgpt-3-5-turbogpt-4
The AI Agent Workforce Platform — where teams scale beyond headcount. Give every team member an AI agent squad.
★ 1,738Goupdated 2026-04-19agent-orchestrationagentsmeshai-agentai-agent-workforce-platformai-coding
An index of the LangChain + LangGraph ecosystem: concepts, projects, tools, templates, and guides for LLM & multi-agent apps.
★ 1,736JavaScriptupdated 2026-04-14aiawesomeawesome-listlangchainlanggraph
🚀🚀🚀 A collection of some awesome public YOLO object detection series projects and the related object detection datasets.
★ 1,728updated 2025-05-31cudadatasetsdeepseekfew-shot-object-detectiongui
Rigourous evaluation of LLM-synthesized code - NeurIPS 2023 & COLM 2024
★ 1,725Pythonupdated 2025-10-02benchmarkchatgptefficiencygpt-4large-language-models
A community-driven collection of RAG (Retrieval-Augmented Generation) frameworks, projects, and resources. Contribute and explore the evolving RAG ecosystem.
★ 1,715updated 2026-04-17aiartificial-intelligencelarge-language-modelsllmmachine-learning
GPTeam: An open-source multi-agent simulation
★ 1,715Pythonupdated 2026-04-16agentsaiautogptgpt-4
An agentic company research tool powered by LangGraph and Tavily that conducts deep diligence on companies using a multi-agent framework. It leverages Google's Gemini 2.5 Flash and OpenAI's GPT-5.1 on the backend for inference.
★ 1,703Pythonupdated 2026-04-17agentsaicompanyfinancial-analysisgemini
DATAGEN: AI-driven multi-agent research assistant automating hypothesis generation, data analysis, and report writing.
★ 1,699Pythonupdated 2026-04-18agentaiai-data-analysisartificial-intelligencecode-generation
Aria is Your AI Research Assistant Powered by GPT Large Language Models
★ 1,692JavaScriptupdated 2025-04-01ai-assistantgptlarge-language-modelsresearch-paperzotero
Curated GPT-Image-2 prompts for the OpenAI API — portraits, posters, UI mockups, game screenshots, character sheets, and more. Ready-to-use prompts for gpt-image-2.
★ 1,692updated 2026-04-23ai-artai-generated-artai-imageapiawesome-list
ChatGPT with superpowers! Search chat history, create folders, export all chats, pin messages, access thousands of community prompts, incognito mode, language and tone selection, and many more features
★ 1,669JavaScriptupdated 2024-06-18chrome-extensionfirefox-addonfirefox-extensionproductivity
Use Kimi latest model(kimi-k2-0711-preview) to drive your Claude Code.
★ 1,663Shellupdated 2025-07-15
Create Custom GPT and add/embed on your site using Assistants api
★ 1,649JavaScriptupdated 2026-02-05aichatbotassistant-apichatbotchatbotschatgpt
Build Anything with AI Agents
★ 1,624TypeScriptupdated 2026-03-17agentic-aiagentic-frameworkai-agentsllmnatural-language-inference
The Context Optimization Layer for LLM Applications
★ 1,593Pythonupdated 2026-04-26agentaianthropiccompressioncontext-engineering
Macaw-LLM: Multi-Modal Language Modeling with Image, Video, Audio, and Text Integration
★ 1,591Pythonupdated 2025-01-01deep-learninglanguage-modelmachine-learningmulti-modal-learningnatural-language-processing
A fast and lightweight framework for creating decentralized agents with ease.
★ 1,586Pythonupdated 2026-04-17agentsaiai-agentsllmmulti-agent-systems
This repository provides an advanced Retrieval-Augmented Generation (RAG) solution for complex question answering. It uses sophisticated graph based algorithm to handle the tasks.
★ 1,586Jupyter Notebookupdated 2025-06-17advanced-ragagentgenailangchainlanggraph
Agentic-RAG explores advanced Retrieval-Augmented Generation systems enhanced with AI LLM agents.
★ 1,582updated 2025-10-20agenticagentic-aiagentic-frameworkagentic-patternagentic-rag
A playground of highly experimental prompts, Jinja2 templates & scripts for machine intelligence models from OpenAI, Anthropic, DeepSeek, Meta, Mistral, Google, xAI & others. Alex Bilzerian (2022-2025).
★ 1,574Jinjaupdated 2025-07-12ai-agentsjinjajinja2-templatesmeta-promptingmultimodal
A high-performance inference engine for AI models
★ 1,568Rustupdated 2026-04-20aihigh-performanceinferencellmmetal
A curated list of awesome resources, tools, and other shiny things for LLM prompt engineering.
★ 1,565Pythonupdated 2026-02-23awesomeawesome-listawesome-listsawesome-readmeawesome-resources
Chat with your data - AI data analysis and visualization on CSV, Postgres, MySQL, Snowflake, SQLite...
★ 1,550TypeScriptupdated 2026-02-11aichartdata-sciencedata-visualizationllm
[GenAI Application Development Framework] 🚀 Build GenAI application quick and easy 💬 Easy to interact with GenAI agent in code using structure data and chained-calls syntax 🧩 Use Event-Driven Flow *TriggerFlow* to manage complex GenAI working logic 🔀 Switch to any model without rewrite application code
★ 1,550Pythonupdated 2026-04-16agentagent-based-frameworkagent-frameworkchatglmclaude
🦙 Local and online AI hub
★ 1,521Pythonupdated 2026-04-08adwaitaflatpakgnomegtk4ollama
An open-source, code-first Java toolkit for building, evaluating, and deploying sophisticated AI agents with flexibility and control.
★ 1,510Javaupdated 2026-04-18agentagenticagentic-aiagentic-workflowagents
Lemon AI is the first Full-stack Open-source Self-Evolving General AI Agent, offering a fully local alternative to Agentic platforms like Manus & Genspark AI.🔔 Official updates X(twitter) @LemonAI_cc
★ 1,507JavaScriptupdated 2026-02-03agentagentic-aiaidesktopfullstack
"Your Fully-Automated Personal AI Assistant"
★ 1,500Pythonupdated 2025-10-16agentdeep-researchllm
Amica is an open source interface for interactive communication with 3D characters with voice synthesis and speech recognition.
★ 1,492TypeScriptupdated 2025-07-23aiassistant-chat-botscomputer-visionllmspeech-recognition
Evaluate your LLM-powered apps with TypeScript
★ 1,487TypeScriptupdated 2026-03-27aievalstypescript
Not just another ChatGPT user-interface!
★ 1,484TypeScriptupdated 2024-06-13chatgptchatgpt-apielectronjavascriptopenai
In the evolving world of Large Language Models (LLMs), crafting effective prompts has become an essential skill. That's why I've created this collection, showcasing the most impactful prompts of the year across various intriguing domains. 🌐
★ 1,483updated 2023-12-13chatgptpromptsprompts-template
Build, run and scale AI agents like API and microservices - observable,auditable and identity-aware from day one.
★ 1,476Goupdated 2026-04-18agentagent-authagent-authenticationagent-indentityagent-scaling
Claude Code settings, commands and agents for vibe coding
★ 1,466Pythonupdated 2026-04-17agentic-aiagentsaiclaude-codeclaude-skills
Common interface for interacting with AI agents. The protocol is tech stack agnostic - you can use it with any framework for building agents.
★ 1,461Pythonupdated 2025-04-08agentsaiai-agentapiauto-gpt
OBS plugin for local speech recognition and captioning using AI
★ 1,458C++updated 2026-04-09ailive-streaminglivestreamobsobs-studio
A curated list of awesome LLM agents frameworks.
★ 1,445Pythonupdated 2026-04-19agentslangchainllm
An LLM-powered autonomous agent platform
★ 1,427TypeScriptupdated 2025-05-27
Make your own story. User-friendly software for LLM roleplaying
★ 1,420TypeScriptupdated 2026-04-18aicharacterschatchatbotclaude
SALMONN family: A suite of advanced multi-modal LLMs
★ 1,412updated 2026-04-20audioaudio-processingaudio-visual-understandingbytedanceiclr2024
Full computer-use for AI agents. Self-learning workflows. Native macOS. No screenshots required.
★ 1,410Swiftupdated 2026-03-23accessibilityai-agentsautomationclaude-codecomputer-use
🔥 A list of tools, frameworks, and resources for building AI web agents
★ 1,408Pythonupdated 2026-04-16aiai-agentsawesomeawesome-listbrowser-automation
AIlice is a fully autonomous, general-purpose AI agent.
★ 1,405Pythonupdated 2025-08-18agentaillmllm-agent
Run local LLMs like llama, deepseek-distill, kokoro and more inside your browser
★ 1,404TypeScriptupdated 2026-04-22agentsaillamallmllm-inference
A (nearly) seamless integration of ChatGPT into Obsidian.
★ 1,390TypeScriptupdated 2026-02-11
Home Assistant custom component of conversation agent. It uses OpenAI to control your devices.
★ 1,380Pythonupdated 2026-04-11conversationcustom-componenthomeassistant
HTTP API for Claude Code, Goose, Aider, Gemini, Amp, and Codex
★ 1,372Goupdated 2026-04-13
AI video agents framework for next-gen video interactions and workflows.
★ 1,367Pythonupdated 2026-01-23agentagent-frameworkai-agentsframeworkllm
An official Qdrant Model Context Protocol (MCP) server implementation
★ 1,366Pythonupdated 2026-03-31claudecursorllmmcpmcp-server
Universal Claude Code workflow plugin with agents, skills, hooks, and commands
★ 1,348Pythonupdated 2026-02-14agent-skillsaiai-agentsclaude-codecodex
⚡️ 10x - Up to 20x faster AI coding with multi-step Superpowers. Open-source agent with smart model routing, BYOK, fully self-hosted.
★ 1,346TypeScriptupdated 2026-01-05ai-agentsanthropicclaudeclaude-codecodex
[EMNLP 2025 Oral] MemoryOS is designed to provide a memory operating system for personalized AI agents.
★ 1,343Pythonupdated 2026-03-24agentlanguage-modelllmlong-term-memoryoperating-system
Custom AI agent platform to speed up your work.
★ 1,332TypeScriptupdated 2026-04-20agentslarge-language-modelsllmrust
Easily select and manage your preferred AI digital assistants on Android.
★ 1,327Kotlinupdated 2026-03-30aiandroidandroid-applicationassistantchatbot
Awesome-LLM-RAG: a curated list of advanced retrieval augmented generation (RAG) in Large Language Models
★ 1,324updated 2026-04-20embeddingslarge-language-modelsllmragrag-embeddings
Awesome-Jailbreak-on-LLMs is a collection of state-of-the-art, novel, exciting jailbreak methods on LLMs. It contains papers, codes, datasets, evaluations, and analyses.
★ 1,323updated 2026-03-30aijailbreakllmllmsprivacy
The Simple Agent Development Kit.
★ 1,319Pythonupdated 2025-08-23adkagent-based-modelingagent-development-kitagentsai
AI Vibe Coding Agent of TS backend server, enhanced by compiler skills, generating 100% working code
★ 1,316TypeScriptupdated 2026-04-16ai-coding-agentall-in-oneautomationbackendgenerated-api
Offline inference engine for art, real-time voice conversations, LLM powered chatbots and automated workflows
★ 1,314Pythonupdated 2026-02-10aiai-artartasset-generatorchatbot
Google AI Studio Starter Apps
★ 1,314TypeScriptupdated 2026-04-09aigeminigemini-apigoogle
The python library for research and development in NLP, multimodal LLMs, Agents, ML, Knowledge Graphs, and more.
★ 1,311Pythonupdated 2026-04-20agentsaillmmcpmcp-client
Visual intelligence for your home.
★ 1,305Pythonupdated 2026-03-23aicctv-detectionhacs-integrationhome-assistantllm
AI Browser Automation
★ 1,294TypeScriptupdated 2026-02-14agentaiautomationchromellm
Bub it. Build it. A hook-first runtime for agents that live alongside people.
★ 1,287Pythonupdated 2026-04-20agentagentsaiai-agentsaiagentframework
List of software that allows searching the web with the assistance of AI: https://hf.co/spaces/felladrin/awesome-ai-web-search
★ 1,286HTMLupdated 2026-03-04aiai-search-engineartificial-intelligenceartificial-intelligence-projectsawesome
👨‍💻 An awesome and curated list of best code-LLM for research.
★ 1,283updated 2024-12-10awesomecode-generationlarge-language-models
Curate a custom library of AI Prompts
★ 1,277JavaScriptupdated 2026-02-17aibrowser-extensionchatgptchrome-extension
Parallax is a distributed model serving framework that lets you build your own AI cluster anywhere
★ 1,259Pythonupdated 2026-04-12blackwellchatbotdecentralized-inferencedeepseekdistributed-systems
Fine-tune LLM agents with online reinforcement learning
★ 1,251Pythonupdated 2024-03-19
BrowserWing turns your browser actions into MCP commands Or Claude Skill, allowing AI agents to control browsers efficiently and reliably. Say goodbye to slow, token-heavy LLM interactions — let agents call commands directly for faster automation. Perfect for AI-driven tasks, browser automation, and boosting productivity.
★ 1,247Goupdated 2026-04-21aibrowsergolangllmreact
Autonomous Agents (LLMs) research papers. Updated Daily.
★ 1,241updated 2026-04-16agentagenticagentic-aiagentsai
Large Language Model based Multi-Agents: A Survey of Progress and Challenges (In IJCAI 2024)
★ 1,238updated 2026-04-19agentlarge-language-modelsllmllmsllms-reasoning
Simple shell script to use OpenAI's ChatGPT and DALL-E from the terminal. No Python or JS required. Formerly https://gptshell.cc
★ 1,238Shellupdated 2024-06-19bashchatbotchatgptchatgpt-apichatgpt-api-wrapper
Samurai-inspired multi-agent system for Claude Code. Orchestrate parallel AI tasks via tmux with shogun → karo → ashigaru hierarchy.
★ 1,237Shellupdated 2026-04-19ai-agentanthropicautomationclaude-codellm
BaseAI — The Web AI Framework. The easiest way to build serverless autonomous AI agents with memory. Start building local-first, agentic pipes, tools, and memory. Deploy serverless with one command.
★ 1,228TypeScriptupdated 2026-04-09aianthropicartificial-intelligencebaseaicohere
Skill that audits and rewrites content to remove AI writing patterns. Use it with your favorite agents including Claude Code, OpenClaw, and Hermes.
★ 1,223updated 2026-04-18ai-writingclaudeclaude-codellmprompt-engineering
SuperEasy 100% Local RAG with Ollama + Email RAG
★ 1,223Pythonupdated 2024-06-04
A curated list of awesome AI assistants. Example Telegram bot with all these assistants can be tested on the link below.
★ 1,215HTMLupdated 2023-12-21awesome-aiawesome-gptawesome-gptsawesome-listbots
OWASP Top 10 for Large Language Model Apps (Part of the GenAI Security Project)
★ 1,213Pythonupdated 2026-02-22aiappsecllmllm-security
🌎💪 BrowserGym, a Gym environment for web task automation
★ 1,206Pythonupdated 2026-03-17aillmwebagent
open-source coding LLM for software engineering tasks
★ 1,201Pythonupdated 2025-09-30
Prompty makes it easy to create, manage, debug, and evaluate LLM prompts for your AI applications. Prompty is an asset class and format for LLM prompts designed to enhance observability, understandability, and portability for developers.
★ 1,200TypeScriptupdated 2026-04-19generative-aillm-evaluationllmspromptengineeringprompty
This repository contains a collection of the best system prompts for ChatGPT, a conversational AI model developed by OpenAI. Star this repository to help us reach 5,000 stars!
★ 1,200updated 2024-12-11chatgptgpt4openai
A generalized information-seeking agent system with Large Language Models (LLMs).
★ 1,197Pythonupdated 2024-06-19agiautogptautonomous-agentschatgptgpt
Self-host the powerful Chatterbox TTS model. This server offers a user-friendly Web UI, flexible API endpoints (incl. OpenAI compatible), predefined voices, voice cloning, and large audiobook-scale text processing. Runs accelerated on NVIDIA (CUDA), AMD (ROCm), and CPU.
★ 1,187Pythonupdated 2026-04-02aiapi-serveraudio-generationchatterboxchatterbox-tts
Connect AI models like Claude & GPT with robots using MCP and ROS.
★ 1,186Pythonupdated 2026-04-20mcpmcp-servermodelcontextprotocolrosros-mcp-server
Install our local first extensions for your favorite AI IDE or Terminal Agent. Sync your conversations to the cloud. File issues and requests.
★ 1,185Goupdated 2026-04-09aichat-historyclaudeclaude-codecodex
Xtreme1 is an all-in-one data labeling and annotation platform for multimodal data training and supports 3D LiDAR point cloud, image, and LLM.
★ 1,185TypeScriptupdated 2025-07-153d-annotationannotationannotation-toolcomputer-visionimage-annotation
TypeScript AI platform with AI chat, Autonomous agents, Software developer agents, chatbots and more
★ 1,183TypeScriptupdated 2025-12-22agentic-frameworkagentsai-agentsai-agents-frameworkai-code-review
🎙️ AI Dictation App - Open Source and Local-first ⚡ Type 3x faster, no keyboard needed. 🆓 Powered by open source models, works offline, fast and accurate.
★ 1,176TypeScriptupdated 2026-04-18aiai-note-taking-appasrdictatedictation
😎 Awesome list of Retrieval-Augmented Generation (RAG) applications in Generative AI.
★ 1,170updated 2026-04-11artificial-intelligencegenerative-ailarge-language-modelsmachine-learningretrieval-augmented-generation
A database of SDKs, frameworks, libraries, and tools for creating, monitoring, debugging and deploying autonomous AI agents
★ 1,167updated 2025-02-26agentagentopsagentsaiai-agents
A curated list of awesome LLM and AI Agent Skills, resources and tools for customising AI Agent workflows - that works with Claude Code, Codex, Gemini CLI and your custom AI Agents
★ 1,160Pythonupdated 2026-04-16anthropicawesome-listawesome-listsclaude-codeclaude-skills
Orchestrate Claude Code, Codex, and Gemini sessions on a multiplayer canvas. Manage git worktrees, track AI conversations, and visualize your team's agentic work in real-time.
★ 1,159TypeScriptupdated 2026-04-19
AI-powered code assistant for Vim. OpenAI and ChatGPT plugin for Vim and Neovim.
★ 1,159Pythonupdated 2026-03-11chatgptcode-generationgeminigpt-4llm
AIPex: AI browser automation assistant, no migration and privacy first. Alternative to Manus Browser Operator、 Claude Chrome and Agent Browser
★ 1,154TypeScriptupdated 2026-04-13accessbility-testingagent-browseragent-skillsbrowser-automationbrowser-use
Context manager for all agents
★ 1,153Shellupdated 2026-03-30aiclaude-codecodexcursor
🥤 RAGLite is a Python toolkit for Retrieval-Augmented Generation (RAG) with DuckDB or PostgreSQL
★ 1,152Pythonupdated 2026-04-16chainlitcolbertduckdbevalslate-chunking
Elixir implementation of a LangChain style framework that lets Elixir projects integrate with and leverage LLMs.
★ 1,146Elixirupdated 2026-04-18aianthropicbumblebeechatgptclaude-ai
A modular voice assistant application for experimenting with state-of-the-art transcription, response generation, and text-to-speech models. Supports OpenAI, Groq, Elevanlabs, CartesiaAI, and Deepgram APIs, plus local models via Ollama. Ideal for research and development in voice technology.
★ 1,119Pythonupdated 2025-11-22
Command Your AI Agent Empire from the CEO Desk — A local-first AI agent office simulator that orchestrates CLI, OAuth, and API-connected agents (Claude Code, Codex CLI, Gemini CLI, OpenCode, and more) as a virtual autonomous company.
★ 1,106TypeScriptupdated 2026-03-16agentic-workflowagentsochestrationopenclawopenclaw-agent
ChatDBG - AI-assisted debugging. Uses AI to answer 'why'
★ 1,098Pythonupdated 2026-01-29c-programmingcpp-programmingdebuggerdebugging-toolsgpt-3
A collection of autonomous agents 🤖️ powered by LLM.
★ 1,087updated 2026-04-16agentagentsllmllm-powered-agentsmulti-agent
Low code tool to rapidly build and coordinate multi-agent teams
★ 1,078TypeScriptupdated 2025-10-27agent-based-frameworkagent-oriented-programmingagenticagentic-agiai
Just a Better Chatbot. Powered by Agent & MCP & Workflows.
★ 1,076TypeScriptupdated 2026-03-23agentaiai-chatbotautomationchatbot
PinchBench is a benchmarking system for evaluating LLM models as OpenClaw coding agents. Made with 🦀 by the humans at https://kilo.ai
★ 1,062Pythonupdated 2026-04-15
AI agent expert in PostgreSQL
★ 1,061TypeScriptupdated 2026-04-20agentaianthropicllmopenai
🤖 / 🏪 Agent Index - This is the agent index for LobeChat. It accesses index.json from this repository to display a list of available agents for LobeChat to the agent market.
★ 1,046TypeScriptupdated 2026-03-20agentaiawesomechatgptlobe-chat-agent
Search + Chat = SearChat(AI Chat with Search), Support OpenAI/Anthropic/VertexAI/Gemini, DeepResearch, SearXNG, Docker. AI对话式搜索引擎,支持DeepResearch, 支持OpenAI/Anthropic/VertexAI/Gemini接口、聚合搜索引擎SearXNG,支持Docker一键部署。
★ 1,043TypeScriptupdated 2026-04-16aianthropicdeepresearchgeminillm
Autonomous GPT-4 agent platform
★ 1,042Pythonupdated 2026-01-01aigpt-4openaipython
Build agents which are controlled by LLMs
★ 1,040Pythonupdated 2025-06-23deep-learninglangchainllmsmachine-learning
Dynamiq is an orchestration framework for agentic AI and LLM applications
★ 1,039Pythonupdated 2026-04-20agentsaigenerative-aigptllm
Readymade evaluators for your LLM apps
★ 1,037Pythonupdated 2026-04-16
GeoIntel using Google's Gemini API to uncover the location where photos were taken through AI-powered geo-location analysis.
★ 1,035HTMLupdated 2026-03-09geolocationimageosint
Retrieval Augmented Generation (RAG) framework and context engine powered by Pinecone
★ 1,032Pythonupdated 2024-11-13generative-aillmragvector-database
Coding Agent Session Manager for Claude Code / Gemini CLI / Codex CLI / Cursor Agent / Copilot CLI / Cline CLI / OpenCode / Kimi CLI
★ 1,031TypeScriptupdated 2026-04-20claudeclaude-codecliclinecodex
AI Agent Evaluator & Red Team Platform
★ 1,025Pythonupdated 2026-04-19agentsaiai-agentse2e-testingllm
🍌 The official starter kit for the Nano Banana Hackathon. Clone this repo to get building fast!
★ 1,024Jupyter Notebookupdated 2025-09-08
TypeScript AI AI Function Calling Framework enhanced by compiler skills.
★ 1,021TypeScriptupdated 2026-04-14agentagenticagentic-aiagentic-frameworkai
📊 llm.report is an open-source logging and analytics platform for OpenAI: Log your ChatGPT API requests, analyze costs, and improve your prompts.
★ 1,017TypeScriptupdated 2024-05-14aiopsgpt-3gpt-4llmllmops
Web UI for AutoGen (A Framework Multi-Agent LLM Applications)
★ 997TypeScriptupdated 2024-11-14agent-based-frameworkaiai-agentsautogenautogen-sample
A pattern for an always on AI Assistant powered by Deepseek-V3, RealtimeSTT, and Typer for engineering
★ 989Pythonupdated 2025-01-12
🔍 LangKit: An open-source toolkit for monitoring Large Language Models (LLMs). 📚 Extracts signals from prompts & responses, ensuring safety & security. 🛡️ Features include text quality, relevance metrics, & sentiment analysis. 📊 A comprehensive tool for LLM observability. 👀
★ 984Jupyter Notebookupdated 2024-11-22large-language-modelsmachine-learningnlgnlpobservability
Simple go utility to download HuggingFace Models and Datasets
★ 966Goupdated 2026-04-11golanghuggingfacellmtransformers
A.S.E (AICGSecEval) is a repository-level AI-generated code security evaluation benchmark developed by Tencent Wukong Code Security Team.
★ 963Pythonupdated 2026-04-15agentaigcbenchmarkcodesecurityllm
CodeProject.AI Server is a self contained service that software developers can include in, and distribute with, their applications in order to augment their apps with the power of AI.
★ 957C#updated 2025-07-14artificial-intelligencegenerative-aimlopsobject-detectiononnx
Use your Claude Max subscription with OpenCode, Pi, Droid, Aider, Crush, Cline. Proxy that bridges Anthropic's official SDK to enable Claude Max in third-party tools.
★ 952TypeScriptupdated 2026-04-20ai-codingaideranthropicbuncharmbracelet
Claude Code for Finance
★ 950Pythonupdated 2026-04-20agentinvestmentlangchainlangraphllm
AgentSociety: Large-scale Social Simulation to Understand Human Behaviors and Society through LLM-driven Agents
★ 950Pythonupdated 2026-04-15
Hexabot is an open-source AI chatbot / agent builder. It allows you to create and manage multi-channel and multilingual chatbots / agents with ease.
★ 942TypeScriptupdated 2026-04-20agentagenticagentsaiartificial-intelligence
An editing tool that uses AI to transcribe, understand content and search for anything in your footage, integrated with ChatGPT and other AI models
★ 936Pythonupdated 2025-02-26aichatgptdavinci-resolveeditingfilm-editing
CLI MCP package manager & registry for all platforms and all clients. Search & configure MCP servers. Advanced Router & Profile features.
★ 933Pythonupdated 2026-03-27aiclaude-desktopcliclinecontinue
Build and run AI agents using Docker Compose. A collection of ready-to-use examples for orchestrating open-source LLMs, tools, and agent runtimes.
★ 929TypeScriptupdated 2026-04-20agentic-workflowsai-agentsdockerdocker-composeexamples
A ChatGPT bot for Kubernetes issues.
★ 918Pythonupdated 2024-11-21chatbotchatgptkubernetesprometheusslack
ChatGPT CLI is a powerful, multi-provider command-line interface for working with modern LLMs. It supports OpenAI, Azure, Perplexity, LLaMA, and more, with features like streaming, interactive chat, prompt files, image/audio I/O, MCP tool calls, and an experimental agent mode for safe, multi-step automation.
★ 917Goupdated 2026-03-22agentagentic-aiazurechatgptcli
A powerful 3B-parameter, LLM-based Reinforcement Learning audio edit model excels at editing emotion, speaking style, and paralinguistics, and features robust zero-shot text-to-speech
★ 913Pythonupdated 2026-04-09audio-editingcross-lingualemotion-controlparalinguisticsreinforcement-learning
Audio Large Language Models
★ 912Pythonupdated 2025-07-05audio-languageaudio-processingaudio-understanding
The Best AI Agent Framework for Agent Collaboration.
★ 908Pythonupdated 2026-04-20agentagentic-aillmopenonion
Labs to explore AI Models, MCP servers, and Agents with the AI Gateway powered by Azure API Management and Microsoft Foundry 🚀
★ 905Jupyter Notebookupdated 2026-04-17a2aagentsapimanagementautogenazure
A curated list of OpenClaw resources, tools, skills, tutorials & articles. OpenClaw (formerly Moltbot / Clawdbot) — open-source self-hosted AI agent for WhatsApp, Telegram, Discord & 50+ integrations.
★ 900updated 2026-04-14agentic-aiai-agentai-automationautonomous-agentsawesome
The most advanced Web UI for AI chat
★ 898HTMLupdated 2026-03-23chatgptchatgpt-uiclaudeclaude2gemini
ChatGPT and Bing AI prompt curation
★ 897updated 2025-06-11aiartificial-intelligencebingchatbotchatgpt
Supercharge AI coding agents with portable skills. Install, translate & share skills across Claude Code, Cursor, Codex, Copilot & 40 more
★ 888TypeScriptupdated 2026-04-12agent-skillsagentskillsaiclicodex
Hand-crafted Claude Code Skills focused on improving agent results quality. Compatible with OpenCode, Cursor, Antigravity, Gemini CLI, and others.
★ 886TypeScriptupdated 2026-04-22agentaiclaudeclinecursor
An open-source alternative to OpenAI and Gemini's deep research.
★ 880TypeScriptupdated 2025-02-12
The best way to create, deploy, and share MCP Servers
★ 868Pythonupdated 2026-04-19aiai-gatewayarcadearcade-aillm-tool-call
Deep research agent to help you find the best GitHub repositories 🕵️!
★ 867Pythonupdated 2026-04-08agentdeep-researchgithub-searchlangchainlanggraph
Browser automation system that uses AI-driven planning to navigate web pages and perform goals.
★ 860Pythonupdated 2026-03-11agentsaiautomation-frameworkautomation-uibrowser
Your local AI Desktop Agent for Windows, macOS & Linux. Agent Skills (SKILL.md), autonomous coding (Codework), multi-agent teams, desktop automation, 15+ AI providers, Desktop Buddy. No Docker, no terminal. Free.
★ 860TypeScriptupdated 2026-04-20ai-agentai-assistantai-companionsautomationautonomous-agent
AgentKit: Build multi-agent networks in TypeScript with deterministic routing and rich tooling via MCP.
★ 846TypeScriptupdated 2026-04-08agentaiai-agent-frameworkai-agentsllm
An open-source framework for collaborative AI agents, enabling diverse, distributed agents to team up and tackle complex tasks through internet-like connectivity.
★ 820Pythonupdated 2025-10-04agentaigenaiioallm
Using Tree-of-Thought Prompting to boost ChatGPT's reasoning
★ 818updated 2023-12-09large-language-modelsllmprompt-engineering
★ 817Pythonupdated 2025-10-23
ChattyUI - your private AI chat for running LLMs in the browser
★ 812TypeScriptupdated 2026-02-07aichatbothuggingfacelocal
WilmerAI is one of the oldest LLM semantic routers. It uses multi-layer prompt routing and complex workflows to allow you to not only create practical chatbots, but to extend any kind of application that connects to an LLM via REST API. Wilmer sits between your app and your many LLM APIs, so that you can manipulate prompts as needed.
★ 811Pythonupdated 2026-04-18aigenerative-aillms
GLM-ASR-Nano: A robust, open-source speech recognition model with 1.5B parameters
★ 797Pythonupdated 2026-03-06asredgellmvoice
CodeGate: Security, Workspaces and Multiplexing for AI Agentic Frameworks
★ 785Pythonupdated 2025-06-05aiai-gatewayaisecurityartificial-intelligenceclaude
Awesome AI Memory | LLM Memory | A curated knowledge base on AI memory for LLMs and agents, covering long-term memory, reasoning, retrieval, and memory-native system design. Awesome-AI-Memory 是一个 集中式、持续更新的 AI 记忆知识库,系统性整理了与 大模型记忆(LLM Memory)与智能体记忆(Agent Memory) 相关的前沿研究、工程框架、系统设计、评测基准与真实应用实践。
★ 784Pythonupdated 2026-04-18agent-memoryai-memoryai-memory-systemawesome-ai-memorycontinual-learning
LLaVA-Plus: Large Language and Vision Assistants that Plug and Learn to Use Skills
★ 766Pythonupdated 2024-02-01agentlarge-language-modelslarge-multimodal-modelsmultimodal-large-language-modelstool-use
AlwaysReddy is a LLM voice assistant that is always just a hotkey away.
★ 763Pythonupdated 2025-03-04
A collection of standardized Agent Skills to teach GitHub Copilot, Claude, Gemini and Cursor about modern Android development (Kotlin, Jetpack Compose, etc.).
★ 759updated 2026-03-28
🍰 PromptLayer - Maintain a log of your prompts and OpenAI API requests. Track, debug, and replay old completions.
★ 759Pythonupdated 2026-04-17gptmachine-learningopenaipromptprompt-engineering
A curated collection of awesome AI Agents and LLM Apps built with multiple tech stacks, showcasing real-world implementations using OpenAI, Gemini, local models, and various AI frameworks.
★ 758HTMLupdated 2026-02-10agentsaiappsautomationframework
An implementation of iterative deep research using the OpenAI Agents SDK
★ 756Pythonupdated 2025-12-27agentic-aiagentsdeep-researchdeepresearchllms
Compare open-source local LLM inference projects by their metrics to assess popularity and activeness.
★ 744updated 2025-11-07
Fully local, private and cross platform Speech-to-Text with LLM Post-processing
★ 730TypeScriptupdated 2026-04-19asrasr-modeldebian-packageslinuxmacos
Sharing early versions of Ada, a personal AI Assistant built on OpenAIs Realtime API
★ 719Pythonupdated 2024-10-20
MCP Server for SearXNG
★ 718TypeScriptupdated 2026-04-05aillmllm-agentmcpmcp-server
[EMNLP 2024 & AAAI 2026] A powerful toolkit for compressing large models including LLMs, VLMs, and video generative models.
★ 711Pythonupdated 2026-04-01awqbenchmarkdeepseek-v3deploymentevaluation
🥥 Coco AI App - Search, Connect, Collaborate, Personal AI Search and Assistant, all in one space.
★ 690TypeScriptupdated 2026-04-17ai-searchai-search-engineassistantcmd-kdeepseek
An agent benchmark with tasks in a simulated software company.
★ 690Pythonupdated 2025-11-17agentaiai-benchmarkai-researchbenchmark
AI coding tools that give free Claude Opus/Sonnet, GPT-5, Gemini Pro, and other pro-grade models
★ 688JavaScriptupdated 2025-12-05aiai-toolsawesome-listcode-generationcoding-assistant
Cross-platform desktop application for content-aware file organization and renaming. Supports local and remote LLMs, preview-based workflows, and fully user-controlled changes.
★ 688C++updated 2026-04-19aifile-managementfile-managerllmorganizer
High-performance Text-to-Speech server with OpenAI-compatible API, 8 voices, emotion tags, and modern web UI. Optimized for RTX GPUs.
★ 686Pythonupdated 2025-07-05ai-text-to-speechai-voiceartificial-intelligence
Agent Cloud is like having your own GPT builder with a bunch extra goodies. The GUI features 1) RAG pipeline which can natively embed 260+ datasources 2) Create Conversational apps (like GPTs) 3) Create Multi Agent process automation apps (crewai) 4) Tools 5) Teams+user permissions. Get started fast with Docker and our install.sh
★ 683TypeScriptupdated 2025-07-21aiautogenchatgptcrewaidockerized-application
Open‑WebUI Tools is a modular toolkit designed to extend and enrich your Open WebUI instance, turning it into a powerful AI workstation. With a suite of over 15 specialized tools, function pipelines, and filters, this project supports academic research, agentic autonomy, multimodal creativity, workflows, and more
★ 681Pythonupdated 2026-04-20academic-researchai-agentsai-workstationarxivcomfyui
Fully open-source command-line AI assistant inspired by OpenAI Codex, supporting local language models.
★ 678Pythonupdated 2025-07-07
ARGO is an open-source AI Agent platform that brings Local Manus to your desktop. With one-click model downloads, seamless closed LLM integration, and offline-first RAG knowledge bases, ARGO becomes a DeepResearch powerhouse for autonomous thinking, task planning, and 100% of your data stays locally. Support Win/Mac/Docker.
★ 676Pythonupdated 2026-01-06agentagentic-aiaiaigcanthropic
The most advanced Nano Banana image generator and editor application. Your central hub for AI image generation and revisions. Intuitive UI features reference images, editing with image masks, version history, and more. Powered by Gemini 2.5 Flash images API.
★ 675TypeScriptupdated 2025-09-17aiimagesboltimageeditingimageeditorimagegeneration
A curated collection of AI agent research papers released in 2026, covering agent engineering, memory, evaluation, workflows, and autonomous systems.
★ 672updated 2026-04-16ai-agentsawesomeawesome-listllmllm-agents
A simple CLI to run LLM prompt and implement MCP client.
★ 672Pythonupdated 2025-12-02langchainllmmcpmodel-context-protocol
A text-based user interface (TUI) client for interacting with MCP servers using Ollama. Features include agent mode, multi-server, model switching, streaming responses, tool management, human-in-the-loop, thinking mode, model params config, MCP prompts, custom system prompt and saved preferences. Built for developers working with local LLMs.
★ 665Pythonupdated 2026-04-15agentic-aiaicommand-line-toolgenerative-ailinux
OmniVinci is an omni-modal LLM for joint understanding of vision, audio, and language.
★ 658Pythonupdated 2026-02-26audio-language-modeldeep-learninglarge-language-modelsmultimodal-large-language-modelsvision-language-model
Easily switch between alternative low-cost AI models in Claude Code/Agent SDK. For those comfortable using Claude agents and commands, it lets you take what you've created and deploy fully hosted agents for real business purposes. Use Claude Code to get the agent working, then deploy it in your favorite cloud.
★ 655TypeScriptupdated 2026-03-26agentsclaudeclaude-agent-sdkclaude-codegemini
Offline Speech Recognition with OpenAI Whisper and TensorFlow Lite for Android
★ 650C++updated 2026-03-18androidasrautomatic-speech-recognitionembeddedmobile
AI-powered video podcast creation skill for coding agents. Supports Bilibili & YouTube, multi-language (zh-CN/en-US), 6 TTS engines (Edge/Azure/ElevenLabs/OpenAI/Doubao/CosyVoice), 4K Remotion rendering.
★ 647Pythonupdated 2026-04-27agent-skillsai-videobilibiliclaude-codeclaude-code-skill
My personal Claude Code and OpenAI Codex setup with battle-tested skills, plugins, hooks and agents that I use daily.
★ 642Pythonupdated 2026-04-17ai-agentsai-toolsclaude-aiclaude-codeclaude-code-plugin
Local Ollama and OpenAI-like GPT's assistance for maximum privacy and offline access
★ 639TypeScriptupdated 2026-04-18
Conversational voice AI agents
★ 630Pythonupdated 2026-04-20agentic-aiagentsai-agentscartesiaconversational-ai
Make contextual data visualization with Chat Interface from tabular datasets. AI data visualization.
★ 624TypeScriptupdated 2025-07-03ai-data-visualisationchartchart-gptchartgptchat2vis
An open-source AI content search engine designed specifically for content creators. Supports extraction of text, images, and short videos. Allows full local deployment (web app, RAG server, LLM server). Supports multi-modal RAG content Q&A.
★ 619TypeScriptupdated 2026-04-09contentcontent-searchragsearchsearch-engine
Real-time transcription using faster-whisper
★ 615HTMLupdated 2024-07-23faster-whisperopenaispeech-recognitionspeech-to-textvoice-recognition
A coding agent and general agent harness for building and orchestrating agentic applications.
★ 612TypeScriptupdated 2026-04-20aiai-agentai-agentsai-toolscontributions-welcome
a magical LLM desktop client that makes it easy for *anyone* to use LLMs and MCP
★ 611Svelteupdated 2025-10-20geminillmllm-clientllmslocal-llm
Tock, the open source conversational AI toolkit.
★ 605Kotlinupdated 2026-04-17aialexaapple-business-chatassistantbot
"VideoAgent: All-in-One Agentic Framework for Video Understanding, Editing, and Remaking"
★ 603Pythonupdated 2025-10-17agentsaudio-editingaudio-understandingllm-agentsnotebooklm
Daydreams is a set of tools for building agents for commerce
★ 603TypeScriptupdated 2026-03-018004agent-frameworkagent-frameworksagentsai
MCP Gateway is a reverse proxy and management layer for MCP servers, enabling scalable, session-aware stateful routing and lifecycle management of MCP servers in Kubernetes environments.
★ 599C#updated 2026-04-16aiapi-gatewayarm-deploymentsasp-net-coreazure
Fast, local-first web content extraction for LLMs. Scrape, crawl, extract structured data — all from Rust. CLI, REST API, and MCP server.
★ 597Rustupdated 2026-04-17aiai-agentsai-scrapingclicrawler
GraphRAG4OpenWebUI integrates Microsoft's GraphRAG technology into Open WebUI, providing a versatile information retrieval API. It combines local, global, and web searches for advanced Q&A systems and search engines. This tool simplifies graph-based retrieval integration in open web environments.
★ 595Pythonupdated 2025-01-10aiagentsgraphragllmsollamaopenai
Elevate vibe coding to vibe engineering: Get consistent Github Copilot custom instructions, Cursor, Roo Code, Cline, Windsurf, Claude Code, Gemini Cli, Codex CLI, kilo code, warp custom rules via a universal, managed template. Features vibe coding memory bank & best practices for large codebases.
★ 594Pythonupdated 2025-10-03claude-codeclinecodex-clicontext-encursor
AgentLab: An open-source framework for developing, testing, and benchmarking web agents on diverse tasks, designed for scalability and reproducibility.
★ 571Pythonupdated 2026-03-17agentagentsbenchmarkevaluation-frameworklab
multilspy is a lsp client library in Python intended to be used to build applications around language servers.
★ 570Pythonupdated 2026-04-16aiai4codeartificial-intelligencecode-analysiscode-completion
Structured deep research skill for Claude Code/Open Code/Codex with human-in-the-loop control
★ 569Pythonupdated 2026-04-10claude-codeclaude-code-skillsdeep-research-agentgpt-skillsllm-agent
The official repo for paper, LLMs-as-Judges: A Comprehensive Survey on LLM-based Evaluation Methods.
★ 565updated 2025-07-29
ChatGPT PROMPTs Splitter. Tool for safely process chunks of up to 15,000 characters per request
★ 565Pythonupdated 2024-02-28ai-conversationscharacter-limitchatgptlanguage-modelnlp-tool
Build agents that scale with a zero-cost abstraction.
★ 564TypeScriptupdated 2025-07-29agentic-aiaibunllmno-frameworks
Minimalist web-searching platform with an AI assistant that runs directly from your browser. Uses WebLLM, Wllama and SearXNG. Demo: https://felladrin-minisearch.hf.space
★ 559TypeScriptupdated 2026-04-20aiai-search-engineartificial-intelligencegenerative-aigpu-accelerated
AI-based stock analysis and trading system
★ 558Pythonupdated 2026-04-15aillmmcpmulti-agentstock
MAD: The first work to explore Multi-Agent Debate with Large Language Models :D
★ 556Pythonupdated 2025-12-16chatgptgpt-4large-language-modelsllmsnlp
Turn PDFs and EPUBs into audiobooks, subtitles or videos into dubbed videos (including translation), and more. For free. Pandrator uses local models, notably XTTS, including voice-cloning (instant, RVC-enhanced, XTTS fine-tuning) and LLM processing. It aspires to be a user-friendly app with a GUI, an installer and all-in-one packages.
★ 551Pythonupdated 2025-04-21audiobookaudiobook-creatoraudiobook-makeraudiobookscustomtkinterprojects
A versatile workflow automation platform to create, organize, and execute AI workflows, from a single LLM to complex AI-driven workflows.
★ 550Pythonupdated 2026-04-14agentagiaiartificial-intelligenceclaude
Self-hosted version of OpenAI’s new stateful Assistants API
★ 550TypeScriptupdated 2025-03-22assistantsgptsopenaiopenai-apiself-hosted
🔥🔥🔥 A curated list of papers on LLMs-based multimodal generation (image, video, 3D and audio).
★ 548HTMLupdated 2025-04-04aigclarge-language-modelslarge-vision-language-modelsllmlvlm
A Dynamic Environment to Evaluate Attacks and Defenses for LLM Agents.
★ 542Pythonupdated 2026-03-30benchmarklarge-language-modelsprompt-injectionsecurity
🤖 AI browser extensions & userscripts to augment your web experience
★ 541JavaScriptupdated 2026-04-23aiamazonartificialintelligencebravechat
AI-agents that automatically generate and use Langchain Tools and ChatGPT plugins
★ 533TypeScriptupdated 2023-04-19
Instruction-based prompts for generating and classifying text.
★ 533updated 2025-11-13chatgptchatgpt-promptsgpt-3gpt-3-promptgpt-3-prompts
AI-powered assistant to help you with your daily tasks, powered by Llama 3, DeepSeek R1, and many more models on HuggingFace.
★ 531Pythonupdated 2025-12-06deepseek-r1llamallama-3-2llama3llava
JobSync is a self-hosted, open-source job application tracker and AI-powered career assistant. Built with Next.js and Shadcn UI, it helps job seekers manage their search journey with AI resume review, job matching, task logging, and application analytics—all while keeping your data private.
★ 530TypeScriptupdated 2026-04-19aiai-job-matchai-resume-analyzerapplication-trackerapplication-tracking-system
State of the Art 82% OSWorld Verified Computer Using Agent, fully open-source, safe, auditable, and production-ready.
★ 529TypeScriptupdated 2026-04-17agentagentic-frameworkaiai-agentsanthropic
Generate and brainstorm ideas while creating your notes using Large Language Models (LLMs) from Ollama, LM Studio, Anthropic, Google Gemini, Mistral AI, OpenAI, and more for Obsidian.
★ 525TypeScriptupdated 2024-09-12anthropic-claudemistralaiobsidian-pluginollamaopenai-api
A personal context store for AI agents and assistants—reuse your existing coding agent CLI (Codex/Claude/OpenCode) with built‑in Skills/tools and a desktop GUI to capture, search, and reuse project knowledge across agents and repos.
★ 524JavaScriptupdated 2026-01-30agentaiai-agentsclaude-codecli
🤖 Awesome list of AGI Agents. Agents 精选资源合集.
★ 524updated 2023-10-31agentsagents-artagiagi-agentsai
Universal MCP-Server for your Databases optimized for LLMs and AI-Agents.
★ 523Goupdated 2025-07-18amazon-bedrockanthropic-claudeapiautomatic-apiclickhouse
AI-powered CMS core for personal blogs and creator websites, with AI summaries, translation, moderation, and writing workflows.
★ 522TypeScriptupdated 2026-04-20aiai-cmsai-summaryai-translationblog-cms
Giselle: AI App Builder. Open Source.
★ 519TypeScriptupdated 2026-04-17agentagent-builderagentic-aiaiai-agent
Use Claude Code / CodeX CLI to perform multiple tasks in parallel with a Codex-style UI. Your personal codex/cursor-background agent. Claude Code UI.
★ 517TypeScriptupdated 2025-11-18claude-codecodexcursor-ai
18 AI personas deliberate your hardest decisions across multiple LLM providers. Aristotle, Feynman, Kahneman, Torvalds & more — structured multi-round deliberation with genuine model diversity. One command: /council
★ 515Shellupdated 2026-04-15ai-agentsclaudeclaude-codedecision-makingdeliberation
A library for easily merging multiple LLM experts, and efficiently train the merged LLM.
★ 511Pythonupdated 2024-08-26artificial-intelligencefine-tuninggenerative-ailarge-language-modelsllm
Enable any LLM (e.g. Claude) to interactively debug any language for you via MCP and a VS Code Extension
★ 507TypeScriptupdated 2025-12-20anthropicautodebugautomationclaudecontext
OpenAI API-compatible wrapper for Claude Code
★ 500Pythonupdated 2026-01-06
Local Video-LLM powered AI Baby Monitor
★ 500Pythonupdated 2025-05-22baby-monitorvideo-llm
[ICLR'25] BigCodeBench: Benchmarking Code Generation Towards AGI
★ 498Pythonupdated 2026-01-03agentagentsbenchmarkchatgptclaude-3
Claw-Eval is an evaluation harness for evaluating LLM as agents. All tasks verified by humans.
★ 495Pythonupdated 2026-04-15agentharnessllmopenclaw
★ 495JavaScriptupdated 2024-06-28
A next-generation AI-powered career platform transforming how employers and job seekers connect
★ 493TypeScriptupdated 2026-03-25cloudinaryfirebasegemini-apinextjsstripe
Manifold is an experimental platform for enabling long horizon workflow automation using teams of AI assistants.
★ 489Goupdated 2026-04-19agentsai-agentsai-assistantai-toolsartificial-intelligence
Huge AI models catalog. A curated list of AI tools, platforms, and resources across various domains.
★ 479Shellupdated 2026-03-18agentsaiartificial-intelligenceartificial-intelligence-algorithmsawesome
Simple yet effective command line client for chatting with ChatGPT using the official API
★ 479Pythonupdated 2025-11-02apichatgptchatgpt-apicliopenai
A centralized manager for Model Context Protocol (MCP) servers with dynamic server management and monitoring
★ 477JavaScriptupdated 2025-10-24aichatgptclaude-aillmslocal-development
Quantalogic ReAct Agent - Coding Agent Framework - Gives a ⭐️ if you like the project
★ 465Pythonupdated 2025-12-02agentsaigenerative-ai
The ultimate no-code platform to build and share AI apps with beautiful UI.
★ 449TypeScriptupdated 2025-05-01aigenerative-aisdfx
No code AI agents
★ 448C++updated 2025-01-16aiai-agentsartificial-intelligencecligpt
Ming-UniAudio: Speech LLM for Joint Understanding, Generation and Editing with Unified Representation
★ 443Pythonupdated 2025-11-27speechspeech-recognitionspeech-synthesisunified-model
An LLM-first SEO analysis skill for Antigravity, Codex, Claude with 16 specialized sub-skills, 10 specialist agents, and 33 optional utility scripts used as evidence collectors.
★ 437Pythonupdated 2026-03-09ai-skillai-skillsantigravity-aiantigravity-skillsantigravity-tools
Build reliable AI Workflows and Agents with humans in the loop, structured outputs and durable execution.
★ 437TypeScriptupdated 2025-11-24aidurable-executiongolangjavacriptllm
End-to-end platform for building voice first multimodal agents
★ 431Pythonupdated 2024-10-28anyscalechatgpt-apiclaude-3-sonnetdeepgramelevenlabs
A tool for evaluating LLMs
★ 430TypeScriptupdated 2026-03-15llmmlops
This project is a digital human that can talk and listen to you. It uses OpenAI's GPT to generate responses, OpenAI's Whisper to transcript the audio, Eleven Labs to generate voice and Rhubarb Lip Sync to generate the lip sync.
★ 430JavaScriptupdated 2026-01-18ai-avatarsdigital-humanelevenlabslip-synclipsync
🎙️ Speak with AI - Run locally using Ollama, OpenAI, Anthropic or xAI - Speech uses SparkTTS, OpenAI, ElevenLabs, Kokoro, Typecast or xAI
★ 427Pythonupdated 2026-04-14ai-speechai-voiceai-voice-agentanthropic-claudeconversational-ai
The best way to use AI is on your own computer. Use local or paid API models, and ctrl+k to show/hide the chat UI. Experience the future of AI, and help build it too!
★ 424Pythonupdated 2025-04-16aichatgptclaudedeepseekhotkeys
A Community Open-Source Saas for Crafting/Building/Creating Chatbots with OpenAI's Assistant API that you can add to your website.
★ 422TypeScriptupdated 2024-10-24aiartificial-intelligenceartificial-neural-networksassistantassistant-app
Deeper Seeker is an simpler OSS version of OpenAI's latest Deep Research feature in ChatGPT.It is an agentic research tool to reason , create multi step tasks , synthesize data from multiple online resources and create neat reports
★ 413Pythonupdated 2025-05-12deepresearchexaopenai
An agent that uses OpenAI's Agents SDK to generate new agents
★ 410TypeScriptupdated 2025-09-22
Integrate AI Assistants with Django to build intelligent applications
★ 409Pythonupdated 2026-03-23aiai-agentai-assistantchatgptdjango
Cannoli allows you to build and run no-code LLM scripts using the Obsidian Canvas editor.
★ 405TypeScriptupdated 2025-11-13
Real-time behavioral enforcement for Claude Code. Monitors AI actions, detects violations, and interrupts misbehavior. Also has a cute pet.
★ 402TypeScriptupdated 2025-10-20agentic-aiagentsclaudeclaude-aiclaude-code
🤖 Intelligent integration between Claude Code and Google Gemini for large-scale code analysis
★ 401Shellupdated 2025-08-17
Jupyter code notebooks of "ChatGPT Prompt Engineering for Developers" by DeepLearning.AI and OpenAI.
★ 401Jupyter Notebookupdated 2023-04-29chatgptexpandinginferringlarge-language-modelssummarizing
A Model Context Protocol (MCP) server that provides tools for fetching and analyzing Reddit content.
★ 395Pythonupdated 2025-05-11llmmcpmodel-context-protocolreddit
Fresh builds of llama.cpp with AMD ROCm™ 7 acceleration
★ 388Pythonupdated 2026-04-19
AI-powered video editor that turns raw footage and a creative brief into a polished ad using an ensemble of AI agents (Google Gemini + FFmpeg)
★ 387Pythonupdated 2026-04-14
Context-Engine MCP - Agentic Context Compression Suite
★ 387Svelteupdated 2026-04-25aiai-agentscodexcompressioncontext
Brower extension to convert web pages to clean Markdown and copy to clipboard so you can feed it to your favorite LLM model as context with just 1 click!
★ 386JavaScriptupdated 2026-03-30aiautomationbrowserchrome-extensiondeveloper-tools
Use Claude Code with any LLM provider - GLM-4.5, Kimi-K2, Qwen3-Coder, DeepSeek, etc.
★ 385Pythonupdated 2025-09-16
🏔️ The AI-native RSS reader
★ 381TypeScriptupdated 2026-04-10aillmnews-readerreactrss
Bring Agent Skills to Any AI Agent and Coding Agent — via CLI or MCP. Manage once, serve anywhere.
★ 380Pythonupdated 2026-01-08agent-skillsai-agentclaudecodexcontext-engineering
On-device AI for Android — LLM chat (GGUF/llama.cpp), vision models (VLM), image generation (Stable Diffusion), tool calling, AI personas, RAG knowledge packs, TTS/STT. Fully offline, zero subscriptions, open-source.
★ 379Kotlinupdated 2026-03-15ai-personasandroidgguf-modelsjetpack-composekotlin
This is a repository to be used when creating a repository template.
★ 379updated 2025-08-12
A curated list of retrieval-augmented generation (RAG) in large language models
★ 379updated 2025-12-01awesome-listawesome-resourcesembeddingslarge-language-modelsllm
Framework to bring LLM applications to production
★ 379Pythonupdated 2026-02-05ailangchainllmllmopsml
The Claude Code alternative
★ 377TypeScriptupdated 2025-04-23ai-tuiboltnewchatgptclaude-codecli
An autonomous LLM-agent for large-scale, repository-level code auditing
★ 377Pythonupdated 2026-03-12code-auditingneuro-symbolic-static-analysissecurity-tools
Create a plan from a description in minutes
★ 374Pythonupdated 2026-04-19agiaillamaindexmcpollama
A collection of Model Context Protocol (MCP) servers, clients and developer tools by IBM.
★ 371updated 2026-04-17agentsllmmcpmodelcontextprotocoltoolcalling
A plugin-based gateway that orchestrates other MCPs and allows developers to build upon it enterprise-grade agents.
★ 367Pythonupdated 2026-01-22agentagent-securitygatewaygen-aigenai
Reproducible, flexible LLM evaluations
★ 366Pythonupdated 2026-03-24
Local coding agent with neat UI
★ 364JavaScriptupdated 2025-05-18aiai-agentsai-frameworkjavascriptlangchain
The Open Assistant API is a ready-to-use, open-source, self-hosted agent/gpts orchestration creation framework, supporting customized extensions for LLM, RAG, function call, and tools capabilities. It also supports seamless integration with the openai/langchain sdk.
★ 362Pythonupdated 2025-06-24agentaiassistantsassistants-apichatgpt
VoxNovel: generate audiobooks giving each character a different voice actor.
★ 360Pythonupdated 2025-06-08audiobook-creatoraudiobooksbooknlpepubgenerative-ai
Open-source CLI coding agent, a free alternative to Claude Code. Generate, debug, and manage code seamlessly.
★ 358Rustupdated 2025-10-30agentclaude-codeclicli-agentcode-agent
Autocomplete your obsidian notes with AI, including ChatGPT, through a copilot-like interface.
★ 355TypeScriptupdated 2024-05-28aiai21labschatgptgroqgroq-ai
🧭 Open source tools for air quality data analysis
★ 352Rupdated 2026-04-27air-qualityair-quality-datameteorologyopenairpackage
Create state-machine-powered LLM agents using XState
★ 350TypeScriptupdated 2026-04-10agentsaillmstate-machinestatechart
This python program allows you to use Claude Code with Google's Gemini models.
★ 345Pythonupdated 2026-02-19anthropicclaudeclaude-codegeminigoogle
VoiceGPT is a voice assistant that leverages the powerful ChatGPT chatbot to answer your questions.
★ 340Pythonupdated 2023-09-28
🚀 Powerful Local AI Chat Application - Mcp, Secure, Efficient, Personalized 本地化部署的大模型客户端
★ 336JavaScriptupdated 2025-06-25deepseekmcpmcp-client
A terminal utility for intelligent shell command generation
★ 333Pythonupdated 2026-03-08aibashdeveloper-toolsfishgemini
A curated list of awesome ChatGPT software.
★ 322HTMLupdated 2025-12-15awesomeawesome-listchatgptopenai
Moonshot - A simple and modular tool to evaluate and red-team any LLM application.
★ 320Pythonupdated 2026-02-05benchmarkingevaluation-frameworkllmred-teamingtrustworthy-ai
A CLI tool for logging and analyzing Claude Code and Cursor ai-driven coding session.
★ 318TypeScriptupdated 2026-04-19ai-assisted-developmentai-codingai-coding-assistantanalysisclaude
A lightweight Python framework for Parallel AI Reasoning.
★ 317Pythonupdated 2026-04-25agentic-workflowaiagentsdecision-makinglangchainlanguage-model
⚡ Stream browser logs to terminal, zero setup, perfect for Ai Agents
★ 316TypeScriptupdated 2026-02-04aibrowserclaude-codecodex-clicursor
Tiledesk is the open source AI agent builder, written in Node.js and Angular. This repository is dedicated to the WebApp dashboard to manage Tiledesk: open-source alternative to Voiceflow, enabling easy creation of advanced LLM-powered Agents with seamless human-in-the-loop (HITL).
★ 314TypeScriptupdated 2026-04-20ai-agentsangualr5angularbotchat
Integrating AI into every workflow with our open-source, no-code platform, powered by the actor model for dynamic, graph-based solutions.
★ 313TypeScriptupdated 2025-02-27actor-frameworkagentagent-based-frameworkaichat
TapeAgents is a framework that facilitates all stages of the LLM Agent development lifecycle
★ 312Pythonupdated 2025-12-16agenticagentsai-agentsfinetuningllm-agent
Prompts for playable games in ChatGPT
★ 310updated 2024-01-08
An MCP server for Massive.com Financial Market Data
★ 308Pythonupdated 2026-04-17cryptocurrencyfintechllmmarket-datamcp
mcp store manager, add & syncs MCP server configurations across clients like Claude code, Cursor💡mcphub
★ 308TypeScriptupdated 2026-04-17aiawesomeclaudedxtllm
A Model Context Protocol (MCP) server that helps read GitHub repository structure and important files.
★ 306Pythonupdated 2025-01-26gitllmmcpmodel-context-protocol
some prompt about cyber security
★ 306updated 2023-07-13
The RAG Experiment Accelerator is a versatile tool designed to expedite and facilitate the process of conducting experiments and evaluations using Azure Cognitive Search and RAG pattern.
★ 303Pythonupdated 2026-04-20acsazurechunkingdenseembedding
Multi-Agent Collaboration Platform✨
★ 303TypeScriptupdated 2026-01-27agentaichatbotmulti-agent
🧠 Second Brain AI agent
★ 289Pythonupdated 2026-04-05artificial-intelligencechatgptchatgpt-apichatgpt-botlangchain
🔍 DiscovAI-Search: An AI-powered search engine for AI tools and custom data. Built with Next.js, OpenAI, Supabase, and more. Features vector-based search, Redis caching, and LLM-powered responses.
★ 286TypeScriptupdated 2024-08-08ai-search-engineai-toolsai-tools-directorychatbotjina
simple web ui to manage mcp (model context protocol) servers in the claude app
★ 286TypeScriptupdated 2026-02-07claudellmmcpmodel-context-protocolreact
AI video generation SDK — JSX for videos. One API for Kling, Flux, ElevenLabs, Sora. Built on Vercel AI SDK.
★ 284TypeScriptupdated 2026-04-27ai-sdkai-videoclaude-codecursorelevenlabs
Seamlessly integrate state-of-the-art transformer models into robotics stacks
★ 284Pythonupdated 2025-12-16agentsartificial-intelligencediffusionembodiedembodied-agent
Calculate prices for calling LLM inference APIs.
★ 282Pythonupdated 2026-04-17
DeepContext is an MCP server that adds symbol-aware semantic search to Claude Code, Codex CLI, and other agents for faster, smarter context on large codebases.
★ 275TypeScriptupdated 2025-09-22aiai-agentsclaudeclaude-codecode
Claude Code with any LLM
★ 275TypeScriptupdated 2025-08-12agentsaiclaude-codellm
Agentic AI platform that harnesses Visual LLM Chaining to build proactive digital assistants
★ 275Pythonupdated 2026-04-16botbot-frameworkbotkitbotschatbot
A universal git-native AI agent framework. Your agent lives inside a git repo — identity, rules, memory, tools, and skills are all version-controlled files.
★ 273TypeScriptupdated 2026-04-22ai-agentsanthropicassistantllmopenclaw
A collection of agents that use Large Language Models (LLMs) to perform tasks common on our day to day jobs in cyber security.
★ 271Jupyter Notebookupdated 2024-05-07adversary-emulationaicalderacybersecurityinfosec
An introduction to the world of AI Agents
★ 268Jupyter Notebookupdated 2026-03-06agentagentic-aiagentsaiautogen
TerminalGPT - Terminal-based ChatGPT personal assistant app. Provides optimized, tailored answers for your machine's terminal.
★ 267Pythonupdated 2025-09-09aiassistantchatgptgenerative-aigenerative-model
A Multi-Agent framework that enables AI agents to collaborate effectively, helping you build powerful agent teams for solving complex tasks.
★ 266Pythonupdated 2026-04-01agentagent-collaborationagentmeshllmmulti-agent
Social and customizable AI writing assistant! ✍️
★ 265TypeScriptupdated 2026-04-07aigeminigemini-progptgpt-4
A manager for AI coding agents that works with Claude Code, Cursor, Gemini, Codex, and Qwen.
★ 261TypeScriptupdated 2026-03-27agentic-aiaiai-agentsclaudecodex
Here are the prompts I’ve created and want to share.
★ 261updated 2023-03-26
An MCP server implementation that provides tools for retrieving and processing documentation through vector search, enabling AI assistants to augment their responses with relevant documentation context.
★ 259TypeScriptupdated 2025-07-18llmmcpmcp-serversragvector-database
Continuous Integration for LLM powered applications
★ 258Pythonupdated 2023-08-11gptlangchainllmpythontest-automation
Web-Use is a CDP powered Browser Agent
★ 257Pythonupdated 2026-04-24agentautomationbrowserllmweb
Microsoft Finance Time Series Forecasting Framework (FinnTS) is a forecasting package that utilizes cutting-edge time series forecasting and parallelization on the cloud to produce accurate forecasts for financial data.
★ 254Rupdated 2026-04-20agentaibusinessfeature-selectionfinance
Vibe code with Claude in parallel git worktrees
★ 253TypeScriptupdated 2026-01-02claudeclaude-codedesktop-appgemini-cligit-worktree
Sample application to add voice capabilities to the Agents SDK
★ 252TypeScriptupdated 2025-05-13
OmniAI standardizes the APIs for multiple AI providers like OpenAI's Chat GPT, Mistral's LeChat, Claude's Anthropic, Google's Gemini and DeepSeek's Chat..
★ 251Rubyupdated 2026-04-17anthropicchatgptclaudedeepseekgemini
AI chat client
★ 249JavaScriptupdated 2025-01-25aiartifactsgemini-prollamamistral
A library of shared system prompts for creating customized educational GPT agents.
★ 247updated 2024-12-18
** THIS REPO HAS MOVED TO https://github.com/langchain-ai/langchainjs/tree/main/libs/langchain-mcp-adapters ** Adapters for integrating Model Context Protocol (MCP) tools with LangChain.js applications, supporting both stdio and SSE transports.
★ 245TypeScriptupdated 2025-05-16agent-toolsai-toolsjavascriptlangchainlangchainjs
Simplified Gemini for Claude Code.
★ 240Pythonupdated 2025-06-10claude-aigemini-flashmcpmcp-server
★ 240Pythonupdated 2025-03-09
Welcome to the ChatGPT Prompts Library! This repository contains a diverse collection of over 100,000 prompts tailored for ChatGPT. Our prompts cover a wide range of topics, including marketing, business, fun, and much more.
★ 240updated 2023-11-23aibardbard-promptschatgptchatgpt-prompt
Your personal free-to-use AI assistant, built with gemini & flutter.
★ 231Dartupdated 2025-02-24embeddingsfluttergeminihive
OpenBrowser is a framework for intelligent browser automation. It combines direct CDP communication with a CodeAgent architecture, where the LLM writes Python code executed in a persistent namespace, to navigate, interact with, and extract information from web pages autonomously.
★ 229Pythonupdated 2026-04-15aiai-agentsai-browserai-browser-automationartificial-intelligence
Lightweight MCP integration bringing Google's Gemini AI capabilities to Claude Code with 1M+ token context window, smart model selection, and powerful code analysis tools
★ 229Pythonupdated 2025-11-16claude-codeclaude-hooksgemini-apigemini-cli
Run Anthropic's Claude Code CLI with OpenAI models such as GPT-5-Codex, GPT-5.1, and others via a local LiteLLM proxy.
★ 229Pythonupdated 2026-01-04anthropicclaude-codeclaude-code-adapterclaude-code-cliclaude-code-proxy
MedEvalKit: A Unified Medical Evaluation Framework
★ 227Pythonupdated 2026-02-24evaluation-frameworkllmmedicalaimultimodal
A Desktop Application for Managing Multiple OpenAI Codex CLI Accounts
★ 227Rustupdated 2026-04-20agentcodexopenaiopenai-codextauri
🧬 Generate visual charts using ECharts with AI MCP dynamically, used for chart generation and data analysis.
★ 227TypeScriptupdated 2026-01-30echartsllmmcpmcp-server
🤖 AI-powered code generation tool for scratch development of web applications with a team collaboration of autonomous AI agents.
★ 225Pythonupdated 2026-04-16aiautonomous-agentcodebase-generationcodegencoding-assistant
The AI Podcast Studio: generate podcasts scripts and their audio version with a team of AI workers in a Podcast Studio 🎙️📜
★ 224Pythonupdated 2025-03-05ag2aiaudio-generationautogenelevenlabs
An AI-powered storytelling video generator that takes user input as a story prompt, generates a story using OpenAI's GPT-3, creates images using OpenAI's DALL-E, adds voiceover using ElevenLabs API, and combines the elements into a video.
★ 216Pythonupdated 2024-09-17aiartificial-intelligencedall-eediting-videosopenai
Bria RMBG 2.0 - image background removee
★ 215Pythonupdated 2025-12-11aibackground-removalbirefnetbriaaigenerative-ai
A curated list of useful Generative AI APIs for developers
★ 214Dartupdated 2026-03-19apigenaigenerative-aigssochacktoberfest
AI-native SaaS framework that builds full-stack apps using autonomous AI agents
★ 214Pythonupdated 2025-07-29ai-agentai-frameworkclaudecode-generationcodegen
[DEPRECATED] Superseded by systempromptio/systemprompt-template and systempromptio/systemprompt-core. Multi-modal MCP client for voice-powered agentic workflows.
★ 210TypeScriptupdated 2025-02-03geminimcpmodel-context-protocolvoice-assistant
Add AI capabilities to your file system using Ollama, Groq, OpenAi and other's api
★ 209TypeScriptupdated 2025-01-04angularfilesystemgpt-4gpt-4ogroq
★ 205Jupyter Notebookupdated 2026-04-17
A playful script to get two AI assistants to converse using OpenAI Assistants API
★ 204Pythonupdated 2023-11-07
A fully autonomous, AI-powered DevOps platform for managing cloud infrastructure across multiple providers, with AWS and GitHub integration, powered by OpenAI's Agents SDK.
★ 203Pythonupdated 2025-03-21
AI agents platform that gives you a workspace with an integrated team of personal assistants that can work behind the scenes to handle daily monotonous tasks.
★ 201Pythonupdated 2026-02-11agent-to-agentagentic-aiagentsaicli
🍃🔎 MongoDB Lens: Full Featured MCP Server for MongoDB Databases
★ 201JavaScriptupdated 2025-04-23aiclaudedatabasellmmcp
A modern, real-time speech recognition application built with OpenAI's Whisper and PySide6. This application provides a beautiful, native-looking interface for transcribing audio in real-time with support for multiple languages.
★ 200Pythonupdated 2025-09-13
Simplify interactions with Large Language Models
★ 200Pythonupdated 2026-03-17aiai-agentsllmllm-agentllm-framework
A powerful Whisper AI keyboard for reliable speech transcription
★ 199Javaupdated 2026-01-06aiandroidgptkeyboardopenai
Official Implementation of InstructZero; the first framework to optimize bad prompts of ChatGPT(API LLMs) and finally obtain good prompts!
★ 199Pythonupdated 2024-07-23black-box-optimizationblack-box-tuningchatgptinstruction-optimizationlarge-language-model
Get up and running with the Gemini API using Node.js and Python
★ 197JavaScriptupdated 2026-04-14geminigemini-api
MongoDB Knowledge Service. Powered by MongoDB and Atlas Vector Search.
★ 196TypeScriptupdated 2025-09-29chatbotmongodbmongodb-atlasragretrieval-augmented-generation
A collection of prompts for use with GPT-4 via ChatGPT, OpenAI API w/ Gradio frontend & notebook
★ 195Jupyter Notebookupdated 2023-08-08chatgptgpt-3gpt-4gradiolangchain
A toolkit for building computer use AI agents
★ 194Pythonupdated 2025-06-26agentsllmmachine-learningmultimodal
workbench for learning and practicing on-device AI technology in real scenario with online-TV on Android phone, powered by ggml(llama.cpp,whisper.cpp...) and FFmpeg and opencv-mobile
★ 192C++updated 2025-06-12ggml-hexagonllamacpp-android-portonline-tvqualcomm-npustablediffusioncpp-android-port
DeepSeek CLI, a command-line AI coding assistant that leverages the powerful DeepSeek Coder models
★ 191TypeScriptupdated 2025-08-25artificial-intelligenceclaudeclaude-aiclaude-codecursor
Tool to work with arXiv, provide LLM with ability to search and read papers from there
★ 191Pythonupdated 2026-02-19
Natural language → ComfyUI workflow JSON. 34 built-in templates, 360+ node definitions, auto model download. Supports txt2img, img2img, txt2vid, img2vid, audio, 3D generation across SD1.5/SDXL/SD3/FLUX/Wan2.2/HunyuanVideo/LTXV/Mochi/Cosmos + LLM integration. Works as a skill for Claude Code, Cursor, and other AI coding agents.
★ 190updated 2026-04-09
Open-source alternative to Claude Cowork - Browser automation & AI assistant powered by DeepSeek
★ 188JavaScriptupdated 2026-02-11claude-cowork-alternativedeepseekdeepseek-coworkopen-sourceopenwork
Samantha OS1 is a conversational AI assistant powered by the Realtime API from OpenAI
★ 186Pythonupdated 2024-12-27agentai-agentopenairealtime-apispeech-to-speech
A framework for standardizing evaluations of large foundation models, beyond single-score reporting and rankings.
★ 183Pythonupdated 2026-04-15aiartificial-intelligenceevaluation-frameworkllmmachine-learning
The Multi-Agent Reasoning framework creates an interactive chatbot where AI agents collaborate via structured reasoning and Swarm Integration for optimal answers. Simulating a team that discusses, debates, and refines responses, it enables complex problem-solving and precise results. Now with Prompt Caching to reduce latency and costs.
★ 181Pythonupdated 2025-01-23agent-based-modelingchatbotmulti-agento1openai
Spongecake is the easiest way to launch computer use agents.
★ 179JavaScriptupdated 2025-04-25ai-agentsai-agents-frameworkautomationcomputer-usedocker
AI-api text generation
★ 175Pythonupdated 2026-03-01
Generate interactive flashcards from your notes using models from OpenAI (ChatGPT), Google (Gemini), Ollama (local LLMs), and more. Or manually create your own to use with the quiz UI.
★ 175TypeScriptupdated 2024-11-13chatgptclaudecohereeducationflashcards
Automate Creation of Story-Based Videos.
★ 173Goupdated 2024-09-22dockergenerative-aigolangllmollama
Input text from speech in any Linux window, the lean, fast and accurate way, using whisper.cpp OFFLINE. Speak with local LLMs via llama.cpp.
★ 172Shellupdated 2025-07-25accessibilityaibloat-freechatbotcli
Convert a Git repo into a ChatGPT prompt!
★ 172Goupdated 2025-09-26chatgptgogolanggptgpt-3
AI Agents are missing the UI! We're here to change it. Build Business AI Agents for your company: business workflows, API's, bookings, e-commerce, social commerce, b2b, CPQ, intake forms, NPS tests, made-to-order use cases
★ 169TypeScriptupdated 2025-12-08agentaib2bbooking-systemchatbot
Awesome ChatGPT prompts for engineers😇
★ 169updated 2023-10-28
MCP SSH Server: 37 tools for remote SSH management | Claude Code & OpenAI Codex | DevOps automation, backups, database operations, health monitoring
★ 168JavaScriptupdated 2026-04-09anthropicautomationbackupclaude-codedatabase
Modern GUI application that transcribes and translate audio files using OpenAI Whisper.
★ 168Pythonupdated 2024-08-12
See how to augment LLMs with real-time data for dynamic, context-aware apps - Rag + Agents + GraphRAG.
★ 165Jupyter Notebookupdated 2026-02-17agentsgenerative-aigraphraglanggraphllms
A curated collection of system prompts and tool definitions from production AI coding agents
★ 164Jinjaupdated 2025-08-04claude-codegemini-cliprompt-engineeringsystem-prompts
GameWorld: Towards Standardized and Verifiable Evaluation of Multimodal Game Agents
★ 162Pythonupdated 2026-04-24agentbenchmarkcomputer-usegamegui
Like ChatGPT's voice conversations with an AI, but entirely offline/private/trade-secret-friendly, using local AI models such as LLama 2 and Whisper
★ 161Pythonupdated 2024-08-20ai-assistantai-assistantsandroiddesktopkoboldai
Model Context Protocol server that integrates AgentQL's data extraction capabilities.
★ 161Shellupdated 2026-04-14agentagentqlaiaiagentclaude
Model Context Protocol (MCP) Server for Langfuse Prompt Management. This server allows you to access and manage your Langfuse prompts through the Model Context Protocol.
★ 161TypeScriptupdated 2025-02-16langfusellmllmopsmcpmodel-context-protocol
Build a powerful Deep Research AI agent like Gemini or ChatGPT. Using Next.js, Vercel AI SDK, and Exa Search API, An intelligent system that generates follow-up questions, crafts optimal search queries, and compiles comprehensive research reports.
★ 158TypeScriptupdated 2026-01-09aiai-agentai-agentschatgptdeep-research
Python CLI for AI Chat with MCP support
★ 157Pythonupdated 2026-04-18
This is my collection of helpful priming prompts for ChatGPT when discussing various angles of software development and architecture.
★ 154updated 2023-11-24aiarchitecturechatgptchatgpt-promptchatgpt-prompts
Terminal-based AI Coding Agent, similar to Claude Code, OpenAI Codex etc. but works with many more LLMs e.g. Gemini, Groq, Deepseek
★ 153Pythonupdated 2025-05-02
Dynamically expose tools from proxied servers based on an Agent Persona
★ 152TypeScriptupdated 2025-10-21agentsclaude-codehypertoolhypertool-mcpllms
Ollama conversation integration for Home Assistant
★ 152Pythonupdated 2024-06-17aihacshassollama
Multi-Agent Conversation Framework in TypeScript
★ 151TypeScriptupdated 2025-04-11agent-based-frameworkagentschatchat-applicationchatbot
A Model Control Protocol (MCP) server that allows Claude to communicate with locally running LLM models via LM Studio.
★ 151Pythonupdated 2026-04-10
VividNode: Multi-purpose Text & Image Generation Desktop Chatbot (supporting various models including GPT).
★ 151Pythonupdated 2026-04-20aichatbotchatgpt-desktopclaudegemini
Connect any Open Data to any LLM with Model Context Protocol.
★ 150Pythonupdated 2024-12-20llmmcpopen-data
Build, test and manage your AI Agents in the central place.
★ 149Svelteupdated 2026-04-17agentaibotsharpchatbot
Automatically generate engaging AI podcasts from nothing but an episode title.
★ 144Pythonupdated 2025-07-28anthropicelevenlabsgeminilangchainllm
Typst MCP Server is an MCP (Model Context Protocol) implementation that helps AI models interact with Typst, a markup-based typesetting system. The server provides tools for converting between LaTeX and Typst, validating Typst syntax, and generating images from Typst code.
★ 144Pythonupdated 2026-04-18llmmcppandoctypst
This MCP or multiple AI setup let claude code use Grok, Gemini and DeepSeek for reviewing and fixes
★ 142Pythonupdated 2025-09-03
Command line artificial intelligence - Your local LLM context-feeder
★ 142Goupdated 2026-04-20aiclicontext-feedergogolang-tools
All-in-one local low-code AI agent development platform. Installs and runs n8n, Flowise, Browser-Use, Qdrant, Ollama, and more. Proxies LLM requests through LiteLLM with Langfuse for observability.
★ 142TypeScriptupdated 2026-02-03
Job search Agent (AI) searches and applies to jobs on your behalf, creating tailored applications for positions that match your skills, making your entire job search hassle-free.
★ 142Pythonupdated 2026-04-13agentaiai-agentsassistantautomation
This repo aims to record resource of role-playing abilities in LLMs, including dataset, paper, application, etc.
★ 141updated 2024-09-23awesome-listllmnlprole-playing
Obsidian canvas plugin for using AI completion with threads of canvas nodes
★ 141TypeScriptupdated 2024-07-31gptobsidian
Desktop AI assistant for Windows, Mac and Linux
★ 140JavaScriptupdated 2025-02-02appchatgptchatgpt-appcopilotcopilot-chat
Local RAG researcher agent built using Langgraph, DeepSeek R1 and Ollama
★ 140Pythonupdated 2025-02-13ai-agentsdeep-researchdeepseekdeepseek-r1langchain
[DEPRECATED] Superseded by systempromptio/systemprompt-template and systempromptio/systemprompt-core. MCP server for orchestrating AI coding agents (Claude Code CLI & Gemini CLI).
★ 139TypeScriptupdated 2025-07-03aiclaude-codegemini-climcpmcp-server
ChatGPT page with API instand of offical pages. You can modify params, save and download the result as txt with prompt.
★ 138Vueupdated 2023-02-22chatgptvuevue3
Neo AI integrates into the Linux terminal, capable of executing system commands and providing helpful information.
★ 134Pythonupdated 2026-03-09aigptiakali-linuxlinux
An Agentic Deep Research Assistant similar to Gemini and OpenAI Deep Research
★ 134Pythonupdated 2025-02-27
Multi-agent collaboration plugin for Claude Code - orchestrate multiple AI agents (Codex CLI, Gemini CLI, etc.) for diverse perspectives
★ 131JavaScriptupdated 2025-12-24
A command-line personal assistant that integrates with Google Calendar, Gmail, and Tasks to help manage your digital life.
★ 130Pythonupdated 2025-09-18chatbotclaude-3-5-sonnetllmopenrouter
Auto classification plugin for Obsidian using ChatGPT.
★ 130TypeScriptupdated 2025-09-09
Prompt Engineering Research Tool for AI APIs
★ 129TypeScriptupdated 2026-04-09ai-researchgpt-3obsidian-mdobsidian-pluginopenai
HaluMem is the first operation level hallucination evaluation benchmark tailored to agent memory systems.
★ 126Pythonupdated 2026-01-08aibenchmarkhallucinationhallucination-evaluationllm
AI tools for OSINT
★ 126updated 2026-04-05aiartificial-intelligencechatgptchatgpt-apigemini
This repo includes ChatGPT content creation prompt curation to use ChatGPT for content creation better.
★ 125HTMLupdated 2023-04-11chatgptcontent-creation
A ChatGPT bot trained on your vault notes. Ask your AI questions about your own thoughts and ideas!
★ 124TypeScriptupdated 2023-06-03
Harness GPT's expertise with curated prompts for consistent, high-quality professional consultations.
★ 122updated 2023-06-20aichatgptgptllmprompt
💬 Fast, cross-platform CLI and GUI for batch transcription, translation, speaker annotation and subtitle generation using OpenAI’s Whisper on CPU, Nvidia GPU and Apple MLX.
★ 121Pythonupdated 2026-04-06asrautomatic-speech-recognitionmlxmlx-audiospeech-recognition
An Android keyboard that performs speech-to-text (STT/ASR) with OpenAI Whisper and input the recognized text; Supports English, Chinese, Japanese, etc. and even mixed languages.
★ 119Kotlinupdated 2025-12-21androidandroid-imeautomatic-speech-recognitionchinese-speech-recognitionime
Welcome to AgentGenesis, your source for customizable Gen AI code snippets that you can easily copy and paste into your applications.
★ 118TypeScriptupdated 2026-03-31aicontentlayergenerative-aihacktoberfesthacktoberfest-accepted
This project is a Streamlit-based web application that leverages OpenAI's Assistants API to provide a ChatGPT-like experience. Users can have real-time conversations with the AI, upload documents to be used as context, and even scrape and convert website content to PDFs to enrich the AI's knowledge base.
★ 118Pythonupdated 2023-11-10
Automatically generate high-quality markdown context files for AI coding agents like Claude, Cursor, and Gemini, Powered By DeepWiki
★ 116TypeScriptupdated 2026-03-23claude-codecursorllm
A Home Assistant custom component that provides an AI-powered agent capable of generating automations based on natural language queries. The agent connects to all entities in your Home Assistant instance and uses OpenAI's or Llama API to translate user requests into valid Home operations including creating automations for you!
★ 115Pythonupdated 2026-04-20aiai-agenthacshacs-integrationhome-assistant
simplifies the process of creating and managing LLM workflows.
★ 115Pythonupdated 2024-10-21aillmnlp-librarynlp-machine-learningprompt-engineering
Lightweight, simple embedded Open WebUI widget, allowing you to easily implement chatbot capabilities and RAG workflows into your existing tools, apps and webpages!
★ 114Svelteupdated 2025-09-03aiartifical-intelligencellmopen-webuiopenwebui
Here is over 200 AI prompts that covers Blog Writing, Email Marketing , YouTube Ad Scripts, Facebook Ad,YouTube Video Ideas,Twitter Thread ,Cold DM Ideas,Influencer Marketing and Copywriting and Instagram Story.
★ 114updated 2023-02-08aibardbingchatgptchatgpt3
A simple to use python library for creating podcasts with support for many LLM and TTS providers
★ 113Pythonupdated 2026-03-03
A minimal, end‑to‑end deep‑research agent implemented with AI SDK and Next.js
★ 113TypeScriptupdated 2025-08-18ai-chatbotai-sdkaisdkdeep-researchnextjs
Researcher Agent to write blog posts/ articles using Amazon Bedrock and websearch.
★ 113Pythonupdated 2026-02-05agentic-aiagentic-workflowai-researcherbedrockdeep-research
Automated Miulti AI Agent for company research with LangGraph— scrapes web data, extracts business insights, and generates structured reports using LLM analysis.
★ 112Pythonupdated 2025-10-25
A comprehensive evaluation framework for AI agents and LLM applications.
★ 110Pythonupdated 2026-04-17agenticagentic-aiaievaluationmachine-learning
One-stop shop for AI skills and agents. Search 110K+ community skills, install and track them declaratively, and deploy across all major AI coding tools (Claude Code, Codex, Cursor, Antigravity and more)
★ 109Rustupdated 2026-04-19ai-agentsai-skillsai-toolsantigravityclaude
SourceGPT - prompt manager and source code analyzer built on top of ChatGPT as the oracle
★ 109Pythonupdated 2023-04-14chatgptopenai
The coding agent for professionals
★ 108TypeScriptupdated 2025-08-18aianthropicclaudellmmcp
demo app: how to use LLM as a general purpose classifier
★ 108TypeScriptupdated 2023-06-04
This shows the results from using a second, filter LLM that analyses prompts before sending them to GPT-Chat
★ 108updated 2022-12-06
A Dall-E 3 localhost web UI for using advanced settings like style (vivid vs natural) or quality (standard vs hd). Can also be used when ChatGPT's Dall-E throttles you for the day, if you are ready to pay the API call costs. Comes integrated with Prompt Inspirer!
★ 105JavaScriptupdated 2025-05-10
A serverless, AI-powered deep research agent built with Cloudflare Workers and Google Gemini 2.5
★ 104TypeScriptupdated 2026-03-15aiai-agentcloudflarecloudflare-workersdeep-research
A plugin for Obsidian that allows you to create a canvas conversation using ChatGPT.
★ 104TypeScriptupdated 2023-03-18
This repo collects research papers that use AI tools and are in the field of scientific research (including computer science, agronomy, chemistry, physics, etc.). We call this method as Deep-Research.
★ 103updated 2025-03-17agentaillmsresearchscience-research
ChatGPT Desktop Application Supercharged with prompts
★ 101JavaScriptupdated 2023-08-31appchatchatgptelectrongenerative
Use AI chatbots like Claude or ChatGPT, particularly their projects function, to help track, diagnose, and recovery from chronic illness.
★ 100updated 2025-01-09
Automated system for LLM evaluation via agents.
★ 97Pythonupdated 2026-04-13agentagentsbenchmarkdatadata-analysis
High-performance LLM evaluation framework with parallel API calls — up to 17× faster than sequential tools. Supports box, math, and logit-based evaluation.
★ 96Pythonupdated 2026-04-11evalevaluationllm
A visual node-based editor for building, sharing, and executing complex AI workflows with Fal.ai and Replicate.
★ 96TypeScriptupdated 2025-11-23aicomfyui-webfal-aigenerative-ailow-code
Local-GenAI-Search is a generative search engine based on Llama 3, langchain and qdrant that answers questions based on your local files
★ 96Pythonupdated 2024-08-19generative-ailangchainlarge-language-modelsllama3local
Home Assistant Card to display the LLM Vision Timeline
★ 95updated 2026-03-23custom-carddashboardfrontendhome-assistantllmvision
An LLM GUI application; enables you to interact with your files, offering dynamic parameters that can modify response behavior during runtime.
★ 95Pythonupdated 2026-04-08chunkingdependency-inversion-principledockerembeddingsfactory-pattern
Promptdesk is a tool designed for effectively creating, organizing, and evaluating prompts and large language models (LLMs).
★ 95TypeScriptupdated 2025-08-29javascript-librarylarge-language-modelsllmllm-agentllm-apps
End-to-end workflow to automatically generate show notes from audio/video transcripts
★ 94TypeScriptupdated 2026-02-25assembly-aichatgptclaudedeepgramgemini
MCP OAuth Proxy incl. dynamic client registration (DCR), MCP prompt analytics and MCP firewall to build enterprise grade MCP servers.
★ 93Goupdated 2026-04-19agentsapi-gatewayauthentication-middlewaredevopsdex
Precis is an extensible self-hosted AI-enabled RSS reader with a focus on notifications and support for theming
★ 93Pythonupdated 2024-12-15aidaisyuidockerdocker-composefastapi
★ 87Pythonupdated 2024-06-09
Deep Research through Multi-Agents, using GraphRAG
★ 86JavaScriptupdated 2025-08-21autogenazuredeep-researchgpt-4ographrag
Open-source FRED MCP Server (Federal Reserve Economic Data)
★ 84TypeScriptupdated 2026-03-22datadata-analysis-projectfinancefinancial-analysisgenai
☕ GPT-2 chatbot for daily conversation
★ 84Pythonupdated 2022-02-14chatbotgpt-2nlp
吴恩达《ChatGPT Prompt Engineering for Developers》课程中文版
★ 84Jupyter Notebookupdated 2023-04-28
AI-powered tool for automatic podcast script and audio generation.
★ 83Pythonupdated 2025-08-14artificial-intelligencechatgptpodcast
Personal Context Manager for Claude Code. Your life in walnuts.
★ 82Pythonupdated 2026-04-20ai-agentai-toolsanthropicautomationclaude-code
A reference containing useful prompts for ChatGPT. Many prompts have parameters that allow you to customize them to your liking.
★ 82updated 2023-03-19
An MCP server that provides LLMs with efficient access to package documentation across multiple programming languages
★ 80TypeScriptupdated 2025-07-18aidocsdocumentationgojavascript
One-Click-Deploy Your Own Advanced ChatGPT-prompts-database by Vercel🙌一键部署个人Prompts的数据库,除了Prompts,还有Prompting Engineer的相关资料!
★ 78JavaScriptupdated 2024-11-13chatgptchatgpt-prompt-engineeringchatgpt-promptsdockerprompt-engineering
A ComfyUI custom node for Google's Gemini 2.5 Flash Image (aka "Nano Banana") model - the state-of-the-art image generation and editing AI that went viral for its incredible quality and capabilities.
★ 77Pythonupdated 2025-08-27
★ 77Jupyter Notebookupdated 2025-10-04
Skills to augment LLM thinking process, integrated with InfraNodus insight generation tool
★ 76Shellupdated 2026-04-11claudeclaude-skillsinfranodusshopping
The first and largest GPTs database
★ 76updated 2023-11-15chatgptgpt-storegptsgptstore
😎 Sagentic.ai Agent Framework - Sagentic.ai is a unified platform for building, running and scaling autonomous agents.
★ 76TypeScriptupdated 2026-03-10aiartificial-intelligenceautonomous-agentsgpt-4llm
Build Awesome MCPs with Awesome Best Practices for MCP Servers and MCP Clients
★ 75updated 2025-08-16awesomeawesome-listllmmcpmcp-server
Real-time speech recognition & AI-powered note-taking app for macOS with offline/online modes, multilingual transcription, and Japanese translation support.
★ 75TypeScriptupdated 2026-02-03macosmcpmcp-clientopenaiscreenshot
A list of LLM benchmark frameworks.
★ 74updated 2024-02-17awesome-listbenchmarkevaluationllm
Multi-Agent Blog Generator based on Agno framework. Supports leading LLM providers like OpenAI, Gemini, Claude, and Grok.
★ 74Pythonupdated 2026-01-06agentic-aiagentsagnoai-agentsclaude
A very simple whsper Python FastAPI for OpenAI API, Android voice-typing (konele), Home Assistant (wyoming), and a voice-typing script on Linux and MacOS!
★ 74Pythonupdated 2025-12-28fastapikoneleopenaiwhisper
Record, transcribe, and transform voice notes into structured insights. Leverage Whisper or AssemblyAI and ChatGPT to fill in gaps, generate summaries, and visualize ideas — all seamlessly integrated within Obsidian.
★ 72TypeScriptupdated 2026-02-24assemblyaiobsidianopenaivoice-assistant
A curated list of awesome Gemini Nano Banana model cases, prompts, and sources
★ 72updated 2025-08-29
Stable Diffusion Desktop client for Windows, macOS, and Linux built in Embarcadero Delphi.
★ 71Pascalupdated 2023-08-15aiartificial-intelligencecodeformerdeepfloyddelphi
ChatGPT Prompts for Devops Mastery
★ 71updated 2025-01-21
A decision operating system for high-stakes choices — business, strategy, career. Simulates disagreement, stress-tests assumptions, and converges on what actually holds up. Claude Code skill inspired by Karpathy's autoresearch + LLM council.
★ 70Pythonupdated 2026-04-20
MCP Deep Research Server using Gemini creating a Research AI Agent
★ 70TypeScriptupdated 2025-08-12aiai-agentsai-researchai-research-assistantai-researcher
Web Graphical User Interface (GUI) for Gas Town multi-agent orchestrator - A companion interface for steveyegge/gastown
★ 68JavaScriptupdated 2026-04-09agentagent-orchestratoragentic-aiagentic-workflowclaude-code
This repository provides resources and guidelines to facilitate the integration of Open-WebUI and Langfuse, enabling seamless monitoring and management of AI model usage statistics.
★ 68Pythonupdated 2025-05-02dockerdocker-composelangfusellmllm-webui
Simple GUI around whisper.cpp for voice-to-text on Linux
★ 67Pythonupdated 2026-04-08dictationlinuxopenaipromptvoice
Shinkai allows you to create AI agents without touching code. Define tasks, schedule actions, and let Shinkai write custom code for you. Native crypto support included.
★ 67Rustupdated 2026-04-19aichatgptguillama3llm
Cerno is a local-first research platform that leverages agentic AI to break down complex queries into verifiable, multi-step workflows. Switch seamlessly between cloud LLMs and self-hosted models, track every reasoning step, and optimize cost and tokens—all while keeping your data on your machine.
★ 66Pythonupdated 2025-09-11agentic-aiagentsanthropicautonomous-agentsclaude
Claude Code with any LLM provider (OpenRouter, Gemini, Kimi K2)
★ 66Goupdated 2025-08-16
Token-efficient data serialization for LLM/AI. 50% fewer tokens than JSON, 93% better value/token. Rust, schema validation, LSP.
★ 65Rustupdated 2026-04-20ai-mlclicsvdata-formatjson-alternative
A powerful command-line interface for interacting with DeepSeek's AI models.
★ 65Pythonupdated 2026-03-29
Lets to use local llms in your Obsidian Vaults, extend your stories or create entirely new texts based on your previous input
★ 65TypeScriptupdated 2024-06-30aillmlocalobsidianollama
ChatGPT Desktop Application with prompts hint and voice control
★ 64JavaScriptupdated 2023-04-07aichatgptdesktop-appgptgpt-3
Universal MCP Server Configuration Manager
★ 62TypeScriptupdated 2026-01-22claudeclicursorgeminimcp
Zettelkasten note taking powered by Large Language Models
★ 62TypeScriptupdated 2025-11-28
Transcribe audio and video files with speaker diarization and logically grouped timestamps using Gemini Flash
★ 61Svelteupdated 2026-04-07geminigemini-flashspeaker-diarizationspeech-to-textsveltekit
★ 61Pythonupdated 2025-02-13
Advanced ChatGPT Prompts
★ 61updated 2023-05-28
Open AI Chat Bot in the Menu Bar: ChatGPT desktop app for Windows, Mac, and Linux
★ 60TypeScriptupdated 2026-01-08aiai-chatai-chatbotchatchatbot
Desktop application for Linux and Windows that utilizes distil-whisper models from HuggingFace, to enable real-time offline speech-to-text dictation.
★ 60Pythonupdated 2025-10-16desktop-appdictationdistil-whisperhuggingfaceoffline
Every Eval Ever is a shared schema and crowdsourced eval database. It defines a standardized metadata format for storing AI evaluation results — from leaderboard scrapes and research papers to local evaluation runs — so that results from different frameworks can be compared, reproduced, and reused.
★ 59Pythonupdated 2026-04-25agent-evaluationai-evaluationevaluationsinfrallm-evaluation
Mark web pages for use with vision-language models
★ 59TypeScriptupdated 2026-03-08claudecomputer-usecomputer-using-agentcuagemini
An Obsidian plugin to process text, chat with AI, and semantically search your notes — works with any OpenAI-compatible LLM server (Ollama, LM Studio, vLLM, and more).
★ 59TypeScriptupdated 2026-04-18
🤖 Community fork of Google's Gemini CLI for Qwen AI models. A powerful command-line tool that uses Alibaba Cloud's Qwen models to understand your code, automate workflows, and accelerate development. Features multilingual support (EN/CN), model switching, and web search integration.
★ 57TypeScriptupdated 2025-07-05aialibabacloudautomationchinesecli
A tool to OCR PDFs using gen-AI models
★ 57Pythonupdated 2026-04-07aigptgroqhacktoberfestocr
open-source, local-first AI CLI for developers. It connects to your local Ollama models or remote providers like OpenAI, Anthropic, Gemini, and Hugging Face, letting you chat with your code, review changes, and craft commits — all from the terminal.
★ 56TypeScriptupdated 2026-01-11aiclaude-codeclicodexdeveloper
This is a Streamlit application that allows two local Ollama models to chat with each other.
★ 55Pythonupdated 2025-10-21
AI-Powered Podcast Generator: A Python-based tool that converts text scripts into realistic audio podcasts using Google's Generative AI API. This project leverages advanced text-to-speech technology to create dynamic, multi-speaker conversations with customizable voices.
★ 55Pythonupdated 2024-12-16gemini-2-0-flash-expgenerative-language-apigoogle-aigoogleapis
Professional AI assistant configurations for Claude Code, Codex CLI, OpenCode and Gemini CLI with enterprise-grade defaults for Solidity and TypeScript development.
★ 54Shellupdated 2025-12-15claude-codecodexcursor
🎯 AI-powered voice assistant for TickTick, enabling natural language task management through speech. Built with OpenAI's speech recognition and TickTick's API integration, this assistant helps you manage your todos hands-free - create tasks, set reminders, and organize your schedule using just your voice.
★ 54Pythonupdated 2025-02-24
A curated list of all things awesome about OpenAI
★ 54Jupyter Notebookupdated 2024-07-19artificial-intelligencejavascriptjsonnlp-machine-learningopenai
Automatically generate subtitles from an input audio or video file using OpenAI Whisper
★ 53TypeScriptupdated 2026-03-17ffmpegopenaiopenai-whispersubtitle-generatorsubtitles
An MCP server to communicated with, use, and wrap the API for the OpenAI Codex CLI tool.
★ 53Pythonupdated 2025-04-18
Open Source multi-modal LLM environment. Host your own web and mobile chat interface, powered by real-time bots and voice AI functionality.
★ 53TypeScriptupdated 2025-10-14
A curated list of materials on AI guardrails
★ 52Pythonupdated 2025-06-03awesomedeepfake-detectiongenaiguardrailsinappropriate-content
An MCP Server for audio transcription using OpenAI
★ 52Pythonupdated 2025-10-16
Rules and instructions for agentic coding tools like Cursor, Claude CLI, Gemini CLI, Qodo, Cline and more
★ 52TypeScriptupdated 2026-04-10agentic-aiagentic-workflowai-agentsclaude-codecopilot
Open-ended wargames with large language models
★ 52Pythonupdated 2026-02-11human-ai-teaminglarge-language-modelsmulti-agent-systemstabletop-exerciseswargames
AI-powered CLI tool to automatically organize your GitHub Stars into Lists.
★ 51TypeScriptupdated 2026-02-03automationbunclicurationdeveloper-tools
A skill to claude code that enables brainstorming with other LLMs (ChatGPT, Gemini) before presenting the implementation plan to the user
★ 51Pythonupdated 2026-01-08claude-code-skillclaude-code-skillsclaude-skills
Use Large Language Models (such as ChatGPT) to automatically generate flashcards from obsidian notes
★ 50JavaScriptupdated 2025-07-07
OpenAI-compatible TTS API that unifies multiple backends with smart chunking for unlimited-length generation
★ 49Pythonupdated 2025-12-08
Ask GPT from your notes and get personalized answers based on your knowledge base.
★ 49TypeScriptupdated 2023-05-21obsidian-mdobsidian-plugintypescript
Curated list of real‑world AGENTS.md files, templates, guides & tools for OpenAI Codex‑based agents.
★ 47updated 2025-08-20agents-mdawesome-listdocumentationopenai-codexprompt-engineering
An index of prompting libraries for GPTs, including ChatGPT. Some of these are on Github and others are hosted externally.
★ 45updated 2024-11-21
A Claude Code framework for multi-llm planning and development agents
★ 44Pythonupdated 2026-04-10
Local RAG server for code editors. Scans your codebase, builds a local context index, and connects to any external LLM for context-aware completions and assistance.
★ 44Pythonupdated 2025-09-11ai-assistantclaudecodegendeepseekgemini
MCP server for Fal.ai - Generate images, videos, music and audio with Claude
★ 43Pythonupdated 2026-03-30ai-toolsclaudefal-aiimage-generationllm
Do literature review Fast, Simple and Reliable
★ 42Pythonupdated 2025-04-02agentic-aiaideep-researchgeminiliterature-review
List of prompts for chatGPT for various assistances with tasks.
★ 42updated 2024-11-14chatgptopenai
A LLM project as a part of CS-5660
★ 40updated 2023-12-16
MovieGPT: A RAG, Gen AI application for Movie Recommendations
★ 38Jupyter Notebookupdated 2024-08-19chatgptlarge-language-modelsllama-indexllmrecommendation-systems
Let the OpenAI LLM add nodes to your Obsidian canvas
★ 38TypeScriptupdated 2026-01-17
Self-correcting image generation for Gemini's Nano Banana model
★ 37Pythonupdated 2025-10-09
A real-time, offline voice assistant for Linux and Raspberry Pi. Uses local LLMs (via Ollama), speech-to-text (Vosk), and text-to-speech (Piper) for fast, wake-free voice interaction. No cloud. No APIs. Just Python, a mic, and your voice.
★ 37Pythonupdated 2026-04-20androidchatbotdeep-learningechoesp-idf
MCP server that gives Claude ability to use OpenAI's GPTs assistants
★ 37Pythonupdated 2025-09-12
A fully local, open-source voice-to-text tool that acts as a system-wide AI dictation layer, converting speech into clean, formatted text.
★ 35Goupdated 2026-04-13clidarwingolanglinuxllm-tools
A modern project scaffold for AI-assisted development workflows—providing reusable Claude Code commands (.claude/commands/), structured AI documentation (ai_docs/), and standardized feature specifications (specs/) to streamline collaboration with Claude Code and OpenAI Codex.
★ 35updated 2025-09-15
Multi-Agent Debugger: An AI-powered debugging system using CrewAI to orchestrate specialized agents that analyze logs, trace code, and uncover root causes across your stack — powered by LLM providers.
★ 35Pythonupdated 2025-07-22ai-toolsautonomous-agentscode-analysiscrewaidebugging
AI-powered image generation using Google Gemini, integrated with Claude Code via Skills or Claude.ai via MCP (Model Context Protocol).
★ 34JavaScriptupdated 2026-03-15claudeclaude-codeclaude-extensionsclaude-pluginsclaude-skills
Discover the ultimate collection of top AI prompts for ChatGPT, Bard, and beyond. Elevate your prompt skills with this open-source project. Unleash the full potential of AI-driven interactions. 🔥
★ 33JavaScriptupdated 2023-07-13aibardchatgptjavascriptnextjs
Easy to use, scalable admin portal for deploying and managing AI Assistants
★ 32TypeScriptupdated 2024-07-02aichatgptgoogle-gemini-aigoogle-gemini-proopenai
A VSCode extension for running LLM prompts. It turns VSCode into a powerful prompt IDE.
★ 32TypeScriptupdated 2024-10-11
Automate ChatGPT prompt input from Airtable data
★ 32JavaScriptupdated 2023-03-07airtableairtable-extensionchatgptopenaiopenai-api
Prompt Engineering for Everybody with ChatGPT and GPT4, by Packt Publishing
★ 32updated 2023-11-17
LLM Gateway to call 100+ LLM APIs in OpenAI format with MCP supported.
★ 31Goupdated 2025-10-02
An AI-powered content generator app using NextJs, React, TailwindCss, Drizzle, Typescript, Gemini, and Clerk. Implement authentication, built a modern UI, set up a Postgres database, and utilised Google Gemini API to generate content with.
★ 31TypeScriptupdated 2025-03-07clerk-authclerkjsdrizzle-ormgemini-apineondb
Compare and generate AI videos across Sora, Veo, Kling, Seedance & more.
★ 30TypeScriptupdated 2026-04-26ai-toolsai-video-generationai-video-generatorfal-aigenerative-ai
Learn how multimodal AI merges text, image, and audio for smarter models
★ 30Jupyter Notebookupdated 2025-01-21dalle-3deepgramdiffusiondreamboothgenerative-ai
Universal AI CLI & Python SDK for 8+ providers (OpenAI, Claude, Gemini, Cohere, Perplexity, IBM watsonx, Groq, Together AI). Multi-provider chat, code generation, cost optimization, age-appropriate AI. Claude Code/Gemini CLI alternative with zero vendor lock-in.
★ 30Pythonupdated 2026-02-21
A free and open-source library of AI prompts.
★ 30Svelteupdated 2023-10-06chatgptchatgpt-promptchatgpt-prompts
Claude Multi-Agent Project Management Framework - AI-driven orchestration with LangGraph and OpenAI integration
★ 29Pythonupdated 2025-07-23agenticclaude-codecodeorchestration-framework
The Yahoo Finance Agent is an application that combines OpenAI's LLMs, the Yahoo Finance Python library, and LangChain's tools to provide real-time financial data. It features stock information, financial statements, and an interactive chat interface, all while maintaining conversation context and integrating with Langsmith for debugging
★ 28HTMLupdated 2024-08-10langchainlangsmithopenaiopenai-fupython
Open DeepResearch is an application for assisting in research by conducting comprehensive research on any topic.
★ 28Pythonupdated 2025-02-11agentic-aiaideep-researchllmopen-source
A cross-platform desktop application that records audio and transcribes it to text using OpenAI's Whisper API or compatible services. Perfect for dictation, note-taking, and accessibility.
★ 27C#updated 2026-03-21
A study assistant powered by Claude Opus. It provides various tools to assist with different tasks, such as researching,coding,note-taking and more.
★ 26Pythonupdated 2024-07-18aillmpythonrag
awesome for your to collections
★ 26updated 2023-03-30awesome-listprompt-engineering
💹 StockSim: Multi-Agent LLM Financial Market Simulator — A realistic trading simulation platform for evaluating large language models in dynamic financial environments.
★ 25Pythonupdated 2025-07-15algorithmic-tradinganthropicasyncbacktestingdocker
A simple API that provides information about various Large Language Models (LLMs) and their pricing
★ 25JavaScriptupdated 2024-08-21
💬 Experience OpenAI ChatGPT assistance directly within Obsidian, drafting content without interrupting your creative flow.
★ 25JavaScriptupdated 2025-02-11chatgpt-apigptobsidianobsidian-mdobsidian-plugin
Text-to-speech plugin for Claude Code — multi-provider support (ElevenLabs, OpenAI, Google, Amazon Polly, Azure, Kitten, local system TTS) on macOS, Linux, and Windows
★ 24Shellupdated 2026-04-15accessibilityaudioclaude-codeclaude-code-pluginelevenlabs
A stand-alone application with GUI for OpenAI's Whisper
★ 24Pythonupdated 2024-04-04guihacktoberfestiwr-hacktoberfestopenaipyinstaller
Professional Wargaming LLM Toolbox
★ 23Pythonupdated 2025-07-09
Multi-AI consensus MCP server that queries multiple AI models (OpenAI, Claude, Gemini, custom APIs) in parallel and synthesizes responses to reduce bias and improve accuracy. A Python implementation of the wisdom-of-crowds approach for AI decision making.
★ 23Pythonupdated 2025-06-26ai-consensusai-synthesisai-toolclaudeclaude-desktop
🚀 Claude Code API | CLI to API Platform | Transform Claude CLI, Gemini CLI, Cursor CLI into REST APIs | One-Click Deploy | Web Terminal
★ 23HTMLupdated 2025-10-29aiai-poweredapi-generatorautomationclaude-ai
Prompt Management System for Interaction with the ChatGPT API
★ 23JavaScriptupdated 2026-04-07aiaudio-transcribingimage-generationprompt-databaseprompts
An application that enable the users to upload PDF files and ask questions regarding their content using Retrieval Augmented Generation (RAG)
★ 23Pythonupdated 2024-10-18aicosine-similarityembeddingsgoogle-drive-apigpt-4
AI-powered deep research tool leveraging web scraping for cost-effective, comprehensive analysis. Open-source and API-cost free!
★ 23HTMLupdated 2025-03-03bing-searchchat-historychatbotcustom-instructionsduck-duck-go
makes the jewish library accessible to LLMs through the MCP protocol
★ 22Pythonupdated 2025-04-17aijudaismllm
InsightA is an Obsidian plugin, can transform long articles into concise, atomic notes, and create well-organized Map of Content (MOC) for notes using LLM. This tool is ideal for anyone aiming to distill complex information into structured, interconnected notes, drawing inspiration from the Zettelkasten method.
★ 22TypeScriptupdated 2024-11-06aillmobsidianobsidian-plugin
Automatically categorize your GitHub starred repos into Star Lists using LLM.
★ 21Pythonupdated 2026-03-08github
Use Claude Code CLI with any LLM provider - OpenAI, local models, or any OpenAI-compatible API
★ 21Pythonupdated 2025-09-06
Python command-line tool for interacting with AI models through the OpenRouter API/Cloudflare AI Gateway, or local self-hosted Ollama. Optionally support Microsoft LLMLingua prompt token compression
★ 21updated 2025-12-28ai-ragcloudflare-aicloudflare-ai-gatewaylinkupllm-inference
The only tool that replays Claude, Codex, Cursor, AND Gemini AI coding sessions in one unified UI. Vibe coding companion for reviewing, searching, and sharing your AI pair programming transcripts.
★ 21TypeScriptupdated 2026-02-03ai-pair-programmingai-transcriptclaudeclaude-codecodex
MCP server that enables AI agents to analyze projects, initialize vibe unified rules for AI coding across Claude Code, Cursor, GitHub Copilot, and Gemini CLI
★ 21TypeScriptupdated 2026-03-12
An interactive AI voice agent that can capture and transcribe speech in real-time, generate intelligent responses using the DeepSeek R1 (7B model) AI, and convert the responses back to natural speech for immediate playback. The agent maintains conversation context and supports cross-platform usage on macOS, Linux, and Windows.
★ 20Pythonupdated 2025-06-20assemblyaideepseekdeepseek-r1elevenlabsportaudio
Train and use generative text models in a few lines of code.
★ 20Pythonupdated 2021-12-05gpt-2gpt-3huggingface-transformersnatural-language-generation
The best Android keyboard for offline speech recognition, using OpenAI's whisper model through whisper.cpp for fast and accurate output.
★ 19Kotlinupdated 2025-02-22
A Python tool that uses Google Gemini API to transcribe video or audio files into SRT subtitle files.
★ 19Pythonupdated 2026-01-02asrgeminigemini-apitranscribe
UI for the OpenAI API
★ 19TypeScriptupdated 2026-03-24
The LLM Council works together to answer your hardest questions
★ 18Pythonupdated 2026-03-12llm-agentsllm-as-a-judgellm-councilllm-toolsmcp
🐕 Universal MCP Server Manager - Configure once, manage multiple MCP servers through a single interface. Perfect for Claude Desktop, Claude Code, Cursor, Gemini CLI & AI assistants. Web dashboard, auto-detection, unified proxy layer.
★ 18TypeScriptupdated 2025-10-19ai-assistantclaudecursormcpmodel-context-protocol
A Model Context Protocol (MCP) server that enables Claude Desktop to interact with Google's Gemini AI - featuring 7 tools with Smart Tool Intelligence that learns from your usage patterns
★ 17JavaScriptupdated 2025-12-02
🤖 A Telegram bot that integrates with OpenWeb UI's OpenAI compatible APIs to provide chat functionality written in Go
★ 17Goupdated 2024-05-26
A small script that types what you say using whisper while holding a hotkey
★ 15Pythonupdated 2025-11-19openaipython3speach-recognitionspeach-to-texttyping-assistant
AI-powered file launcher and semantic search assistant. Like Spotlight/Alfred but with advanced AI capabilities for understanding context and meaning. Features local processing, privacy-first design, and seamless integration with your workflow.
★ 15TypeScriptupdated 2025-09-25aialfreddesktopdocument-searchelectron
Create your assistant in the OpenAI dashboard, generate an API key, and use this code to integrate it into Open WebUI. Remember that it is a function, not a pipeline.
★ 15Pythonupdated 2025-01-20
★ 15TypeScriptupdated 2024-03-09
🔭 My open-source implementation of Deep Research using Google’s new Gemini 2.0 Flash model.
★ 14TypeScriptupdated 2025-02-08
Running Ollama and Open WebUI in a Kubernetes Cluster
★ 14updated 2024-12-02
★ 14Jupyter Notebookupdated 2023-06-28
Simple Prompt Plugin is a plugin for Obsidian that allows you generate content in your notes using LLMs.
★ 14TypeScriptupdated 2024-06-16aillmnodeobsidianobsidian-md
🤖 AI-powered ADR generation - Automatically capture and document architectural decisions as you code
★ 13TypeScriptupdated 2026-04-16adrarchitectural-decision-recordscicdcoding-agentscontinues-ai
A gateway service designed to manage and orchestrate OpenAI-compatible API servers with MCP support.
★ 13Rustupdated 2026-01-12gatewaymcpmcp-clientopenai
Privacy-first meeting transcription and voice-to-text tool for Linux. 100% local AI processing with faster-whisper and Ollama.
★ 13Shellupdated 2026-04-19
Node.js app that transcribes WhatsApp voice notes to text using OpenAI's Whisper API. The text can also be translated to the user's preferred language and sent back to their WhatsApp account.
★ 13HTMLupdated 2026-04-17
An open source deep research clone. AI Agent (Local LLM or Gemini) that reasons large amounts of web data extracted with SwiftSoup.
★ 13Swiftupdated 2025-02-10
Chrome extension that allows dictating anywhere using OpenAI Whisper
★ 13JavaScriptupdated 2023-09-29chrome-extensiondictationopenaiopenai-apitext-to-speech
OpenRouter skill for AI agents: model discovery, multimodal chat, tool calling, routing, and starter templates.
★ 12TypeScriptupdated 2026-03-05agent-skillai-agentsexpressllm-toolsmultimodal
Star Manager is a local-first web app for organizing GitHub starred repositories with Star Lists and optional LLM-assisted classification.
★ 12TypeScriptupdated 2026-03-26
Open-source voice-first AI assistant for Android that actually controls your phone.
★ 12TypeScriptupdated 2026-03-27agentai-assistantandroidclaudedriving-code
Turn any Excel spreadsheet into LLM consumable JSON
★ 12Pythonupdated 2026-02-28
Skill management tool for AI agents - discover and install pre-built workflows from Anthropic, OpenAI, and community sources
★ 12Rustupdated 2026-03-27aiclaudeclicodexrust
Open-source clone of OpenAI's Deep Research. Works with any transformer, gpt4free, & runs in browser. No Firecrawl needed.
★ 12JavaScriptupdated 2025-06-12agentsaideep-researchdeepresearchllama
A collection of custom tools and extensions for Open WebUI that enhance its capabilities
★ 12Pythonupdated 2024-12-11aifunctionsllmopen-webuitools
🤖 A CLI tool that transforms web content into polished blog posts using AI. Scrape websites, pull Reddit discussions, and let OpenAI/Claude craft engaging articles - all from your terminal. Features a sleek TUI interface and smart image handling with AI-generated alt text.
★ 11Pythonupdated 2024-11-14aibloggingpython
This is my custom scripts to use Whisper / OpenAI by keyboard shortcuts and voice input.
★ 11Pythonupdated 2023-10-29
A Python-based AI agentic assistant that uses Google's Gemini AI to provide natural language computer control through voice commands.
★ 10Pythonupdated 2025-03-27
★ 10TypeScriptupdated 2023-08-30
SDK, skills, and examples for Inkbox: give your AI agents identities, inboxes, phone numbers, and encrypted vaults.
★ 9TypeScriptupdated 2026-04-17agent-communicationagent-infrastructureagent-toolsai-agentsai-infrastructure
AI-powered web app that automatically generates resumes based on GitHub or LinkedIn profiles using LLM.
★ 9C#updated 2025-08-03ai-apiaspnet-coreazuredockerfastapi
A MCP server that provides audio transcription capabilities using OpenAI's Whisper API
★ 9JavaScriptupdated 2025-03-25
A dictation application on linux using openai's whisper. Currently only used on KDE wayland.
★ 9Pythonupdated 2023-04-11
Local AI CLI alternative to Gemini CLI/Claude Code - works with LM Studio and local models
★ 9TypeScriptupdated 2025-06-28
Convert audio files (flac, mp3, mp4, mpeg, mpga, m4a, ogg, wav, and webm) to SRT subtitles with OpenAI Whisper. Easy script for fast, accurate transcription.
★ 9Pythonupdated 2024-06-11
DeepSeekDeepResearch is a Python-based AI assistant that leverages a local LLM (DeepSeek-R1:7b via Ollama), the Google Custom Search API, and asynchronous web scraping to automatically gather and refine information on any research topic.
★ 9Pythonupdated 2025-02-06
The AI Assistant uses OpenAI's GPT models and Langchain for agent management and memory handling. With a Streamlit interface, it offers interactive responses and supports efficient document search with FAISS. Users can upload and search pdf, docx, and txt files, making it a versatile tool for answering questions and retrieving content.
★ 9Pythonupdated 2024-04-22artificial-intelligencedata-sciencefaisslangchainllms
Kivywhisper is a cross platform Python GUI for OpenAI's Whisper.
★ 9Pythonupdated 2024-07-26
A repository of prompts I've used when working with LLMs as well as some example outputs and notes
★ 9updated 2024-12-07gptllmsprompt-engineeringprompt-tuningprompting
Agent-native image-editing SDK for Claude Code. 21 MCP tools + /decompose skill — semantic layer splits, L1–L5 cultural scoring, region inpaint. Powered by ComfyUI, Gemini, or mock.
★ 8Pythonupdated 2026-04-26agent-nativeaianthropicartclaude-code
Autonomous CLI Agent that uses Local LLM with Ollama to execute tasks in CLI.
★ 8Pythonupdated 2024-09-12autonomous-agentsgptlarge-language-modelsllmollama
Add voice-to-text capabilities to Claude Code using OpenAI Whisper for speech recognition.
★ 8Pythonupdated 2025-08-09
One-key voice-to-transcription tool: record speech, transcribe locally with Whisper, then paste. Never lose your audio files anymore!
★ 8Pythonupdated 2026-03-23chatgptlinuxllmollamaopen-source
AI-powered Design Authority — 5 specialist agents evaluate architecture decisions and deliver structured rulings in under 60 seconds
★ 7Pythonupdated 2026-02-23adraiarchitecturecrewaidesign-authority
The ultimate PyQt6 application that integrates the power of OpenAI, Google Gemini, Claude, and other open-source AI models
★ 7Pythonupdated 2025-12-07agentchatgptclaudedalleevaluator-optimizer-workflow
The TeamAI application allows users to create a team of AI powered assistants with individual capabilities, personas. The AI assistants will solve the task requested by the user as a team effort, each bot contributing with its respective capabilities. Supported providers are Ollama and OpenAI.
★ 7JavaScriptupdated 2025-09-09chat-applicationchatgptdall-egptgpt-4
V1Claw is a self-hosted AI assistant that runs on your Mac, Linux, Windows, or Android via Termux. Connect any LLM (Claude, GPT, Gemini, or local), talk to it through voice or text, and let it control your device - read files, run commands, browse the web, send messages, & more. One binary. No cloud dependency. Your data stays on your machine.
★ 6Goupdated 2026-04-18agentagentic-aiaiclawclawbot
Deepseek-R1 on modal.com using openwebui and ollama - Quick one command run
★ 6Pythonupdated 2025-01-28
LLM supported tools for Homebox storage
★ 6Pythonupdated 2025-03-03
TalkType is a cross-platform application built with Electron, supporting Windows, macOS, and Linux. By combining Automatic Speech Recognition (ASR) with Large Language Models (LLM), it goes beyond simple dictation to offer "Understanding", "Polishing", and "Q&A" capabilities — your all-in-one voice writing assistant.
★ 5JavaScriptupdated 2026-03-01
Linux alternative to Wispr Flow for vibe coding with Cursor but works with any app. Uses OpenAI optionally for dictation clean up.
★ 5Pythonupdated 2026-02-27
AudioWrite: Effortless voice dictation powered by Google's Gemini API. Record, transcribe, and transform rambling audio into polished, multi-language notes. PWA ready.
★ 5TypeScriptupdated 2026-01-05aiaudio-recorderdictationfrontendgemini-api
A chat-based discovery tool leveraging AI function calling to explore diverse content via search APIs. Supports Gemini AI & OpenAI models.
★ 5TypeScriptupdated 2025-02-24aiapibuildwithgeminifunction-callinggemini
arXiv.org ChatGPT Plugin
★ 5JavaScriptupdated 2023-04-07
Finetuning and evaluating LLMs to extract GHG emissions from PDF reports using RAG and grammar-based decoding.
★ 5TeXupdated 2024-03-22data-extractionevaluationinformation-extractionllmlong-context
Fast CLI-first LLM council + bundler + multimodal gateway
★ 4Rustupdated 2026-04-20aiclicode-reviewcoding-agentsllm
Twidi Speech To Text (openai, push to talk, linux, wayland, deepgram)
★ 4Pythonupdated 2026-02-22deepgramopenaiopenai-apipush-to-talkspeech-to-text
Voice dictation for Linux/Wayland (like wisprflow). 100% offline, GPU-accelerated, and actually works with Wayland compositors.
★ 4Pythonupdated 2025-10-09dictationlinuxopenaiwaylandwhisper
An offline-first desktop app to automatically transcribe and edit video subtitles using OpenAI Whisper. Full control over text, timing, and advanced styling in a powerful, intuitive editor.
★ 4Pythonupdated 2025-08-16
🛠️ Build and customize Claude Code agents with tools and Docker isolation for efficient production workflows and advanced reasoning capabilities.
★ 4Pythonupdated 2026-04-20agentic-aiagentic-ai-developmentagentsai-agentsanthropic
WhisperVoice: Covert voice notes. Encrypts text and hides it via LLM-generated acrostic sentences. Murf.ai creates natural audio. Browser extension decrypts with passcode, revealing hidden message or playing decoy for unauthorized listeners. Uses LLM, Murf.ai, STT APIs
★ 4JavaScriptupdated 2025-06-29murf-aimurf-ai-hackathon
Speech-to-Text/Code using a fast local LLM, for Linux, uses Whisper
★ 4Pythonupdated 2025-11-15linuxttswhisperwhisper-ai
LlamaIndex is the leading framework for building LLM-powered agents over your data.
★ 4updated 2025-04-13
Researching use cases for LLMs using Sefaria's data
★ 4updated 2024-10-15
Interact privately with your documents using the power of GPT, 100% privately, no data leaks
★ 4Pythonupdated 2023-10-03
Generate lyric-aligned SRT subtitles with Gemini and review them in a local viewer.
★ 3JavaScriptupdated 2026-04-12geminilocal-firstlyricsplaywrightpython
An Agent SKILL for Israel Rail API
★ 3updated 2026-03-23ai-agentsclawdbotclawdbot-skillllmopenclaw
GPU-accelerated speech-to-text service that types what you say, powered by OpenAI's Whisper AI
★ 3Pythonupdated 2025-10-09accessibilitycudadictationgpu-accelerationlinux
Your voice - VocalFlow dictation, harnessing Whisper and faster-whisper for real-time transcription, adaptive learning, and NLP. Built with Python, it spans Linux, Windows, and macOS, boosting productivity through voice-assisted workflows.
★ 3Pythonupdated 2025-09-08cross-platformdesktop-appdictationfaster-whisperlinux
Real-time desktop audio transcription using OpenAI Whisper for Arch Linux with CUDA acceleration
★ 3Pythonupdated 2025-08-05
A powerful audio transcription server that seamlessly transcribes meeting recordings, generates notes, and intelligently splits audio files for efficient management. Open-source and built with FastMCP and Groq/OpenAI Whisper
★ 3Pythonupdated 2025-06-13
MCP server for real-time audio transcription using OpenAI Whisper
★ 3TypeScriptupdated 2025-10-08
Next.js app for Claude code best practices built with Fumadocs. Document and explore content sources, routes, and MDX docs for fast, scalable docs sites. 🐙
★ 3MDXupdated 2026-04-20agentic-codingai-codingautomationbots-nodeclaude
Simple Python Tkinter GUI App for linux that uses whisper from openai for transcription.
★ 3Pythonupdated 2023-06-22
An admin application I'm developing for managing all aspects of working with LLMs professionally and at scale, with functions for prompt logging, prompt library, and custom LLM agent inventorising. Aspiration: add code to notes gradually as project matures!
★ 3Pythonupdated 2024-09-26
Great online communities discussing use of LLMs including (but not limited to) ChatGPT
★ 3updated 2024-11-21
A reproducible evaluation of how frontier LLMs handle grounded vs. ungrounded questions in RAG systems — measuring correctness, grounding, and calibrated refusal.
★ 2Pythonupdated 2026-04-24ai-safetyanthropicbenchmarkevaluationgemini
Meeting Minutes of the AI Council — Ten Leading AI Models Deliberate on the Human-Machine Trust Crisis Triggered by the Claude Mythos.A transparent experiment for human-AI symbiosis governance.(本项目和会议都是在中文环境下完成,若想看到英文版请自行翻译。)
★ 2updated 2026-04-20aiai-governanceai-safetychinesecommunity
LLM-powered agentic system for Israeli Knesset election analysis — comparing 4 tool routing strategies (DS-UA 301)
★ 2Pythonupdated 2026-04-05
Open-Source Speech-to-Text Evaluation Framework
★ 2Jupyter Notebookupdated 2025-02-12llm-evaluationllm-inferencespeech-to-text
An LLM agent, to talk to your csvs.
★ 2Pythonupdated 2024-04-26
Awesome-LLM: a curated list of Large Language Model
★ 2updated 2023-08-15
Utility for identifying newly released custom ChatGPTs shared via the ChatGPT App Store
★ 2updated 2024-08-07
is a professional-grade translation engine designed to bridge the gap between English and Hebrew with surgical precision. Unlike standard translators, Aegis employs a multi-layered "Shield" architecture featuring automated auditing and AI-driven quality assurance to ensure every line is natural, accurate, and perfectly formatted.
★ 1Pythonupdated 2026-04-27aideepseek-apigemini-apihebrewhebrew-english
Advanced GenAI Legal Ecosystem for Israeli Law. Powered by Autonomous Agents, Multi-Step Tool Calling (Skills), and Gemini Pro. Architected for Precision with RAG, Vector Embeddings, and Agentic Workflows to deliver
★ 1Pythonupdated 2026-04-21
AI Presidential Briefing: Daily knowledge synthesis system with memory layer, LLM council, and LinkedIn post generation
★ 1Pythonupdated 2026-04-23
Product deduplication pipeline for Israeli price-comparison — Hebrew/English normalization, FAISS embeddings, LLM cluster refinement. Pair F1: 0.955
★ 1Pythonupdated 2026-04-07deduplicationembeddingsfaissnlpopenai
A Cloudflare webapp (Nuxt + Hono worker) uses Gemini API to analyze Israeli Payslips
★ 1TypeScriptupdated 2026-04-10
AI Recommendation Platform for Israeli Small Businesses - Get recommended by ChatGPT and Perplexity
★ 1TypeScriptupdated 2026-04-16
Israeli career forecast for hightech industry using LLM forecasting via claude code.
★ 1HTMLupdated 2025-09-24
Terminal UI for chatting with MiMo models through Xiaomi's OpenAI-compatible API
★ 1TypeScriptupdated 2026-03-22
An index of prompting libraries for GPTs, including ChatGPT. Some of these are on Github and others are hosted externally.
★ 1updated 2024-11-21
A fast, lightweight Linux tool that converts speech to text and types it into any window using OpenAI's Whisper API.
★ 1Rustupdated 2025-11-07
Voice-to-text input daemon for Linux using OpenAI Whisper
★ 1Pythonupdated 2025-10-05
Offline Voice Dictation & Text Enhancement A lightweight, 100% local Linux tool for real-time voice‑to‑text transcription and LLM‑powered writing improvements.
★ 1Shellupdated 2025-05-15
from microphone directly to your app
★ 1Rustupdated 2026-04-15aidictationlinuxllmwhisper
Linux voice transcription with hotkey using faster-whisper (local) with optional GPT-4o mini polishing
★ 1Pythonupdated 2026-04-16dictationlinuxparakeetpush-to-talkspeech-to-text
Tests for using multiple different frameworks to replicate "Deep Agents" aka multi-agent systems that run on long tasks (such as Claude Code, OpenAI Deep Research, Manus, etc.)
★ 1Pythonupdated 2025-08-03
Langflow-based LLM agent that keeps track of my personal projects. Based on integration with WhatsApp voice messages, Whisper, OpenAI/Mistral models and local MCP.
★ 1Pythonupdated 2025-06-22
App for transcribing audio/video to editable SRT subtitles using Whisper. Supports mp3/mp4/wav inputs, audio extraction, and local download.
★ 1Pythonupdated 2025-05-26openai-apistreamlit
A clean, stateless AI-powered text transformation tool designed for local AI models and OpenAI-compatible APIs. Each transformation is treated as an independent request with no chat history, optimizing performance for local AI inference.
★ 1TypeScriptupdated 2025-09-26
A free and open-source tool designed to automate typing tasks, with built in AI for advanced users.
★ 1Pythonupdated 2025-04-19ollamapythontkinter-gui
Talk to your documents with Ollama and Langchain - supports CSV, PDF, DOCX, PPTX, TXT, XLSX.
★ 1Pythonupdated 2025-02-18
ChatGPT-generated Python scripts for various purposes
★ 1updated 2024-08-08
LLM-generated documents describing potential use-cases for GPTs & other LLMs across both professional and business contexts with sections describing potential/predicted evolutions as underlying technology advances
★ 1updated 2024-11-28