MCP (Model Context Protocol)

550 repos
Fair-code workflow automation platform with native AI capabilities. Combine visual building with custom code, self-host or cloud, 400+ integrations.
★ 185,610TypeScriptupdated 2026-04-20aiapisautomationclidata-flow
The agent harness performance optimization system. Skills, instincts, memory, security, and research-first development for Claude Code, Codex, Opencode, Cursor and beyond.
★ 167,109JavaScriptupdated 2026-04-19ai-agentsanthropicclaudeclaude-codedeveloper-tools
Production-ready platform for agentic workflow development.
★ 139,176TypeScriptupdated 2026-04-20agentagentic-aiagentic-frameworkagentic-workflowai
User-friendly AI Interface (Supports Ollama, OpenAI API, ...)
★ 134,144Pythonupdated 2026-04-20aillmllm-uillm-webuillms
An open-source AI agent that brings the power of Gemini directly into your terminal.
★ 102,414TypeScriptupdated 2026-04-20aiai-agentscligeminigemini-api
A collection of MCP servers.
★ 85,639updated 2026-04-15aimcp
Model Context Protocol Servers
★ 84,539TypeScriptupdated 2026-04-17
The ultimate space for work and life — to find, build, and collaborate with agent teammates that grow with you. We are taking agent harness to the next level — enabling multi-agent collaboration, effortless agent team design, and introducing agents as the unit of work interaction.
★ 75,654TypeScriptupdated 2026-04-20agentagent-collaborationagent-harnessaichatgpt
The all-in-one AI productivity accelerator. On device and privacy first with no annoying setup or configuration.
★ 58,999JavaScriptupdated 2026-04-17ai-agentscustom-ai-agentsdeepseekkimillama3
⭐AI-driven public opinion & trend monitor with multi-platform aggregation, RSS, and smart alerts.🎯 告别信息过载,你的 AI 舆情监控助手与热点筛选工具!聚合多平台热点 + RSS 订阅,支持关键词精准筛选。AI 智能筛选新闻 + AI 翻译 + AI 分析简报直推手机,也支持接入 MCP 架构,赋能 AI 自然语言对话分析、情感洞察与趋势预测等。支持 Docker ,数据本地/云端自持。集成微信/飞书/钉钉/Telegram/邮件/ntfy/bark/slack 等渠道智能推送。
★ 55,242Pythonupdated 2026-04-18aibarkdata-analysisdockerhot-news
Context7 Platform -- Up-to-date code documentation for LLMs and AI code editors
★ 53,733TypeScriptupdated 2026-04-18llmmcpmcp-servervibe-coding
A cross-platform desktop All-in-One assistant tool for Claude Code, Codex, OpenCode, openclaw & Gemini CLI.
★ 51,481Rustupdated 2026-04-20ai-toolsclaude-codecodexdesktop-appmcp
The best-benchmarked open-source AI memory system. And it's free.
★ 49,688Pythonupdated 2026-04-19aichromadbllmmcpmemory
LocalAI is the open-source AI engine. Run any model - LLMs, vision, voice, image, video - on any hardware. No GPU required.
★ 45,835Goupdated 2026-04-20agentsaiapiaudio-generationdecentralized
Python SDK, Proxy Server (AI Gateway) to call 100+ LLM APIs in OpenAI (or native) format, with cost tracking, guardrails, loadbalancing and logging. [Bedrock, Azure, OpenAI, VertexAI, Cohere, Anthropic, Sagemaker, HuggingFace, VLLM, NVIDIA NIM]
★ 44,731Pythonupdated 2026-04-20ai-gatewayanthropicazure-openaibedrockgateway
an open source, extensible AI agent that goes beyond code suggestions - install, execute, edit, and test with any LLM
★ 43,281Rustupdated 2026-04-20acpaiai-agentsmcp
🦍 The API and AI Gateway
★ 43,260Luaupdated 2026-03-27aiai-gatewayapi-gatewayapi-managementapis
AI Data Vault - A query engine for AI Agents to securely query data from any datasource
★ 39,054Pythonupdated 2026-04-20agentsaianalyticsartificial-inteligencebigquery
🕷️ An adaptive Web Scraping framework that handles everything from a single request to a full-scale crawl!
★ 38,714Pythonupdated 2026-04-18aiai-scrapingautomationcrawlercrawling
Chrome DevTools for coding agents
★ 37,223TypeScriptupdated 2026-04-20browserchromechrome-devtoolsdebuggingdevtools
Enhanced ChatGPT Clone: Features Agents, MCP, DeepSeek, Anthropic, AWS, OpenAI, Responses API, Azure, Groq, o1, GPT-5, Mistral, OpenRouter, Vertex AI, Gemini, Artifacts, AI model switching, message search, Code Interpreter, langchain, DALL-E-3, OpenAPI Actions, Functions, Secure Multi-User Auth, Presets, open-source for self-hosting. Active.
★ 36,001TypeScriptupdated 2026-04-20aianthropicartifactsawsazure
In-depth tutorials on LLMs, RAGs and real-world AI agent applications.
★ 34,110Jupyter Notebookupdated 2026-03-23agentsaillmsmachine-learningmcp
🌊 The leading agent orchestration platform for Claude. Deploy intelligent multi-agent swarms, coordinate autonomous workflows, and build conversational AI systems. Features enterprise-grade architecture, distributed swarm intelligence, RAG integration, and native Claude Code / Codex Integration
★ 33,399TypeScriptupdated 2026-04-11agentic-aiagentic-engineeringagentic-frameworkagentic-ragagentic-workflow
an easy-to-use dynamic service discovery, configuration and service management platform for building AI cloud native applications.
★ 32,903Javaupdated 2026-04-20a2a-registryagentai-registryconfiguration-managementdistributed-configuration
Playwright MCP server
★ 31,413TypeScriptupdated 2026-04-19mcpplaywright
The Open-Source Multimodal AI Agent Stack: Connecting Cutting-Edge AI Models and Agent Infra
★ 29,520TypeScriptupdated 2026-03-27agentagent-tarsbrowser-usecomputer-usecowork
GitHub's official MCP Server
★ 29,254Goupdated 2026-04-16githubmcpmcp-server
Composio powers 1000+ toolkits, tool search, context management, authentication, and a sandboxed workbench to help you build AI agents that turn intent into action.
★ 27,915TypeScriptupdated 2026-04-20agentic-aiagentsaiai-agentsaiagents
FastGPT is a knowledge-based platform built on the LLMs, offers a comprehensive suite of out-of-the-box capabilities such as data processing, RAG retrieval, and visual AI workflow orchestration, letting you easily develop and deploy complex question-answering systems without the need for extensive setup or configuration.
★ 27,833TypeScriptupdated 2026-04-20agentclaudedeepseekllmmcp
An autonomous agent that conducts deep research on any data using any LLM providers
★ 26,707Pythonupdated 2026-04-16agentaiautomationdeepresearchllms
🚀 The fast, Pythonic way to build MCP servers and clients.
★ 24,853Pythonupdated 2026-04-20agentsfastmcpllmsmcpmcp-clients
Build and run agents you can see, understand and trust.
★ 24,347Pythonupdated 2026-04-20agentchatbotlarge-language-modelsllmllm-agent
📦 Repomix is a powerful tool that packs your entire repository into a single, AI-friendly file. Perfect for when you need to feed your codebase to Large Language Models (LLMs) or other AI tools like Claude, ChatGPT, DeepSeek, Perplexity, Gemini, Gemma, Llama, Grok, and more.
★ 23,881TypeScriptupdated 2026-04-20aianthropicartificial-intelligencechatbotchatgpt
Agent2Agent (A2A) is an open protocol enabling communication and interoperability between opaque agentic applications.
★ 23,428Shellupdated 2026-04-19a2aa2a-mcpa2a-protocola2a-serveragents
A powerful MCP toolkit for coding, providing semantic retrieval and editing capabilities - the IDE for your agent
★ 23,423Pythonupdated 2026-04-20agentaiai-codingclaudeclaude-code
From the team behind Gatsby, Mastra is a framework for building AI-powered applications and agents with a modern TypeScript stack.
★ 23,325TypeScriptupdated 2026-04-20agentsaichatbotsevalsjavascript
The official Python SDK for Model Context Protocol servers and clients
★ 22,773Pythonupdated 2026-04-16
AI Agents & MCPs & AI Workflow Automation • (~400 MCP servers for AI agents) • AI Automation / AI Agent with MCPs • AI Workflows & AI Agents • MCPs for AI Agents
★ 21,885TypeScriptupdated 2026-04-20ai-agentai-agent-toolsai-agentsai-agents-frameworkmcp
🔥 MaxKB is an open-source platform for building enterprise-grade agents. 强大易用的开源企业级智能体平台。
★ 20,809Pythonupdated 2026-04-20agentagentic-aichatbotdeepseek-r1knowledgebase
★ 20,624Pythonupdated 2026-01-23
Go language library for reading and writing Microsoft Excel™ (XLAM / XLSM / XLSX / XLTM / XLTX) spreadsheets
★ 20,515Goupdated 2026-04-18agentaianalyticschartecma-376
A MCP for Claude Desktop / Claude Code / Windsurf / Cursor to build n8n workflows for you
★ 18,722TypeScriptupdated 2026-04-20mcpmcp-servern8nworkflows
Give your AI agent eyes to see the entire internet. Read & search Twitter, Reddit, YouTube, GitHub, Bilibili, XiaoHongShu — one CLI, zero API fees.
★ 18,240Pythonupdated 2026-04-13agent-infrastructureai-agentai-searchautomationbilibili
Your API ⇒ Paid MCP. Instantly.
★ 18,130TypeScriptupdated 2026-02-11agentsaillmsopenai
Official, Anthropic-managed directory of high quality Claude Code Plugins.
★ 17,876Pythonupdated 2026-04-20claude-codemcpskills
JavaScript in-page GUI agent. Control web interfaces with natural language.
★ 17,393TypeScriptupdated 2026-04-17agentaiai-agentsbrowser-automationjavascript
Open-source Agent Operating System
★ 17,018Rustupdated 2026-04-19agent-frameworkai-agentsllmmcpopen-source
Rich-text editor with AI and shadcn/ui
★ 16,197TypeScriptupdated 2026-04-16aimcpreactshadcn-uislate
Agent framework and applications built upon Qwen>=3.0, featuring Function Calling, MCP, Code Interpreter, RAG, Chrome extension, etc.
★ 16,178Pythonupdated 2026-03-04
MCP Toolbox for Databases is an open source MCP server for databases.
★ 14,815Goupdated 2026-04-20agentagentsaibigqueryclickhouse
Trigger.dev – build and deploy fully‑managed AI agents and workflows
★ 14,678TypeScriptupdated 2026-04-19aiai-agent-frameworkai-agentsautomationbackground-jobs
MCP server to provide Figma layout information to AI coding agents like Cursor
★ 14,521TypeScriptupdated 2026-04-16aicursorfigmamcptypescript
Memori is agent-native memory infrastructure. A LLM-agnostic layer that turns agent execution and conversation into structured, persistent state for production systems.
★ 13,868Pythonupdated 2026-04-17agentagent-memoryaiai-memoryaiagent
An open-source Agent-first Identity and Access Management (IAM) /LLM MCP & agent gateway and auth server with web UI supporting OpenClaw, MCP, OAuth, OIDC, SAML, CAS, LDAP, SCIM, WebAuthn, TOTP, MFA, Face ID, Google Workspace, Azure AD
★ 13,483Goupdated 2026-04-20agentagentic-aiagiai-gatewayauth
Convert documentation websites, GitHub repositories, and PDFs into Claude AI skills with automatic conflict detection
★ 13,100Pythonupdated 2026-04-12ai-toolsast-parserautomationclaude-aiclaude-skills
Expose your FastAPI endpoints as Model Context Protocol (MCP) tools, with Auth!
★ 11,824Pythonupdated 2025-11-24aiauthenticationauthorizationclaudecursor
The power of Claude Code / GeminiCLI / CodexCLI + [Gemini / OpenAI / OpenRouter / Azure / Grok / Ollama / Custom Model / All Of The Above] working as one.
★ 11,472Pythonupdated 2025-12-15
A blazing fast AI Gateway with integrated guardrails. Route to 200+ LLMs, 50+ AI Guardrails with 1 fast & friendly API.
★ 11,450TypeScriptupdated 2026-03-25ai-gatewaygatewaygenerative-aihacktoberfestlangchain
A cross-platform Markdown AI note-taking software.
★ 11,313TypeScriptupdated 2026-04-16agentchatbotknowledge-basellmmarkdown
Chrome MCP Server is a Chrome extension-based Model Context Protocol (MCP) server that exposes your Chrome browser functionality to AI assistants like Claude, enabling complex browser automation, content analysis, and semantic search.
★ 11,299TypeScriptupdated 2026-01-06
Write HTML. Render video. Built for agents.
★ 10,875TypeScriptupdated 2026-04-20aianimationffmpegframeworkgsap
Bytebot is a self-hosted AI desktop agent that automates computer tasks through natural language commands, operating within a containerized Linux desktop environment.
★ 10,865TypeScriptupdated 2025-09-12agentagentic-aiagentsaiai-agents
ValueCell is a community-driven, multi-agent platform for financial applications.
★ 10,424Pythonupdated 2026-03-09agentic-aiagentsaiassitantcrypto
A collection of projects showcasing RAG, agents, workflows, and other AI use cases
★ 10,258Pythonupdated 2026-04-20agentsaihacktoberfestllmmcp
Context window optimization for AI coding agents. Sandboxes tool output, 98% reduction. 14 platforms
★ 10,172TypeScriptupdated 2026-04-20antigravityclaudeclaude-codeclaude-code-hooksclaude-code-plugins
The fullstack MCP framework to develop MCP Apps for ChatGPT / Claude & MCP Servers for AI Agents.
★ 9,816TypeScriptupdated 2026-04-20agentic-frameworkaiapps-sdkchatgptclaude-code
Visual testing tool for MCP servers
★ 9,559TypeScriptupdated 2026-04-18
Code search MCP for Claude Code. Make entire codebase the context for any coding agent.
★ 9,443TypeScriptupdated 2026-04-20agentagentic-ragai-codingclaude-codecode-generation
Official MCP Servers for AWS
★ 8,869Pythonupdated 2026-04-20awsmcpmcp-clientmcp-clientsmcp-host
A Go implementation of the Model Context Protocol (MCP), enabling seamless integration between LLM applications and external data sources and tools.
★ 8,634Goupdated 2026-04-20
AI Agent Engineering Platform built on an Open Source TypeScript AI Agent Framework
★ 8,483TypeScriptupdated 2026-04-15agentsaiai-agentsai-agents-frameworkaiagentframework
HexStrike AI MCP Agents is an advanced MCP server that lets AI agents (Claude, GPT, Copilot, etc.) autonomously run 150+ cybersecurity tools for automated pentesting, vulnerability discovery, bug bounty automation, and security research. Seamlessly bridge LLMs with real-world offensive security capabilities.
★ 8,298Pythonupdated 2026-03-060x4m4aiai-agentsai-cybersecurityai-hacking
Build effective agents using Model Context Protocol and simple workflow patterns
★ 8,291Pythonupdated 2026-01-25agentsaiai-agentsllmllms
A polyglot document intelligence framework with a Rust core. Extract text, metadata, images, and structured information from PDFs, Office documents, images, and 97+ formats. Available for Rust, Python, Ruby, Java, Go, PHP, Elixir, C#, R, C, TypeScript (Node/Bun/Wasm/Deno)- or use via CLI, REST API, or MCP server.
★ 8,133Rustupdated 2026-04-29buncsharpdocument-intelligenceelixirffi
Put an end to code hallucinations! GitMCP is a free, open-source, remote MCP server for any GitHub project
★ 7,981TypeScriptupdated 2026-03-13agentic-aiagentsaiclaudecopilot
Specification and documentation for the Model Context Protocol
★ 7,928TypeScriptupdated 2026-04-20
Build autonomous AI agents in Python.
★ 7,836Pythonupdated 2026-04-17agentagent-frameworkautonomous-agentautonomous-agentsclaude
The most powerful Android RPA agent framework, next generation mobile automation.
★ 7,754Pythonupdated 2026-03-24adbagentsaiandroidappium
Monitor browser logs directly from Cursor and other MCP compatible IDEs.
★ 7,202JavaScriptupdated 2026-03-18aianthropiccursormcpmcp-server
A community driven registry service for Model Context Protocol (MCP) servers.
★ 6,732Goupdated 2026-04-17mcpmcp-servers
Browser MCP is a Model Context Provider (MCP) server that allows AI applications to control your browser
★ 6,399TypeScriptupdated 2025-04-24browser-automationbrowser-extensionclaudecursormcp
A collection of MCP clients.
★ 6,399updated 2026-04-14clientsmcp
🔥 Official Firecrawl MCP Server - Adds powerful web scraping and search to Cursor, Claude and any other LLM clients.
★ 6,140JavaScriptupdated 2026-04-15batch-processingclaudecontent-extractiondata-collectionfirecrawl
This is MCP server for Claude that gives it terminal control, file system search and diff file editing capabilities
★ 5,953TypeScriptupdated 2026-04-20agentaicode-analysiscode-generationgemini-cli-extension
TypeScript multi-agent orchestration engine — one runTeam() call from goal to result. Multi-model teams, auto task decomposition, parallel execution. 3 runtime dependencies.
★ 5,904TypeScriptupdated 2026-04-20agent-frameworkai-agentsanthropicclaudedeepseek
Context-aware AI assistant for your desktop. Ready to respond intelligently, seamlessly integrating multiple LLMs and MCP tools.
★ 5,852C#updated 2026-04-19agentaiavaloniachatclaude
🐬DeepChat - A smart assistant that connects powerful AI to your personal world
★ 5,738TypeScriptupdated 2026-04-20agentagent-skillsaiai-assistantai-sdk
Klavis AI: MCP integration platforms that let AI agents use tools reliably at any scale
★ 5,718Pythonupdated 2026-04-20agentsaiai-agentsapideveloper-tools
53AI Hub is an open-source AI portal, which enables you to quickly build a operational-level AI portal to launch and operate AI agents, prompts, and AI tools. It supports seamless integration with development platforms like Coze, Dify, FastGPT, RAGFlow.
★ 5,681Goupdated 2026-03-04cozedifyfastgptgomaxkb
WhatsApp MCP server
★ 5,554Goupdated 2025-07-13aimcpwhatsappwhatsapp-api
A multi-model AI agent desktop client — connect any AI provider, extend with MCP & skills, control from your phone. Built with Electron + Next.js.
★ 5,553TypeScriptupdated 2026-04-19aianthropicclaudeclaude-codedesktop-app
Playwright Model Context Protocol Server - Tool to automate Browsers and APIs in Claude Desktop, Cline, Cursor IDE and More 🔌
★ 5,465TypeScriptupdated 2025-12-13
5ire is a cross-platform desktop AI assistant, MCP client. It compatible with major service providers, supports local knowledge base and tools via model context protocol servers .
★ 5,180TypeScriptupdated 2026-03-18knowledge-basellmsmcpmcp-clientmodel-context-protocol
Adversary simulation and Red teaming platform with AI
★ 5,033updated 2026-03-31agentaicobalt-strikellmmcp-server
Your browser is the API. CLI + MCP server for AI agents to control Chrome with your login state.
★ 4,798TypeScriptupdated 2026-04-19
It's like v0 but in your Cursor/WindSurf/Cline. 21st dev Magic MCP server for working with your frontend like Magic
★ 4,791TypeScriptupdated 2026-02-17
Magicrew. The first open-source all-in-one AI productivity platform (Generalist AI Agent + Workflow Engine + IM + Online collaborative office system)
★ 4,783TypeScriptupdated 2026-04-01agentagiaigptllm
ACI.dev is the open source tool-calling platform that hooks up 600+ tools into any agentic IDE or custom AI agent through direct function calling or a unified MCP server. The birthplace of VibeOps.
★ 4,756Pythonupdated 2026-01-08agentsaiai-agentsapideveloper-tools
Model Context Protocol Server for Mobile Automation and Scraping (iOS, Android, Emulators, Simulators and Real Devices)
★ 4,709TypeScriptupdated 2026-04-13agentandroidemulatoriosmcp
UI over MCP. Create next-gen UI experiences with the protocol and SDK!
★ 4,685TypeScriptupdated 2026-03-12aifrontendllmmcpui
ByteRover CLI (brv) - The portable memory layer for autonomous coding agents (formerly Cipher)
★ 4,645TypeScriptupdated 2026-04-20agentaiautonomous-agentsclicoding-assistant
Use any LLMs (Large Language Models) for Deep Research. Support SSE API and MCP server.
★ 4,568JavaScriptupdated 2026-04-14anthropicdeep-researchdeep-research-apideepresearchdeepseek
⚡️AI Cloud OS: Open-source enterprise-level AI knowledge base and MCP (model-context-protocol)/A2A (agent-to-agent) management platform with admin UI, user management and Single-Sign-On⚡️, supports ChatGPT, Claude, Llama, Ollama, HuggingFace, etc., chat bot demo: https://ai.casibase.com, admin UI demo: https://ai-admin.casibase.com
★ 4,503Goupdated 2026-04-26a2aagentagenticagentic-aiagi
Nexent is a zero-code platform for auto-generating production-grade AI agents using Harness Engineering principles — unified tools, skills, memory, and orchestration with built-in constraints, feedback loops, and control planes.
★ 4,360Pythonupdated 2026-04-20agentagentic-aiagentic-frameworkagentic-ragagentic-workflow
Exa MCP for web search and web crawling!
★ 4,326TypeScriptupdated 2026-04-19code-searchcodesearchcrawlingmcpmcp-server
Official Notion MCP Server
★ 4,263TypeScriptupdated 2026-03-18
Build, evaluate, and integrate long-term memory for self-evolving agents.
★ 4,212Pythonupdated 2026-04-20agent-memoryagentic-aiaichatsclawdbot
A simple, secure MCP-to-OpenAPI proxy server
★ 4,157Pythonupdated 2026-02-27mcpmcp-servermcp-to-openapiopen-webuiopenapi
A Model Context Protocol (MCP) server that provides structured spec-driven development workflow tools for AI-assisted software development, featuring a real-time web dashboard and VSCode extension for monitoring and managing your project's progress directly in your development environment.
★ 4,143TypeScriptupdated 2026-03-07
Learn Agentic AI using Dapr Agentic Cloud Ascent (DACA) Design Pattern and Agent-Native Cloud Technologies: OpenAI Agents SDK, Memory, MCP, A2A, Knowledge Graphs, Dapr, Rancher Desktop, and Kubernetes.
★ 4,097Jupyter Notebookupdated 2025-10-26a2aagentic-aidaprdapr-pub-subdapr-service-invocation
Claude Code Guide - Setup, Commands, workflows, agents, skills & tips-n-tricks go from beginner to power user!
★ 4,041updated 2026-04-19aiai-agentai-agent-toolsanthropic-claudeclaude
🤖 A visualization mcp & skills contains 25+ visual charts using @antvis. Using for chart generation and data analysis.
★ 4,016TypeScriptupdated 2026-02-25antvllmmcpmcp-serverskills
A curated list of Model Context Protocol (MCP) servers
★ 4,005updated 2026-04-06
Google 💚 MCP
★ 3,971updated 2026-03-27
Find rules and MCP servers
★ 3,925TypeScriptupdated 2026-04-17
Code, Build and Evaluate agents - excellent Model and Skills/MCP/ACP Support
★ 3,757Pythonupdated 2026-04-23acpagentagent-frameworkagent-skillscli
Context management for Claude Code. Hooks maintain state via ledgers and handoffs. MCP execution without context pollution. Agent orchestration with isolated context windows.
★ 3,731Pythonupdated 2026-01-26agentsclaude-codeclaude-code-cliclaude-code-hooksclaude-code-mcp
Lemonade helps users discover and run local AI apps by serving optimized LLMs right from their own GPUs and NPUs. Join our discord: https://discord.gg/5xXzkMu8Zk
★ 3,676C++updated 2026-04-19aiamdgenaigpullama
★ 3,656TypeScriptupdated 2026-03-31
A framework helps you quickly build AI Native IDE products. MCP Client, supports Model Context Protocol (MCP) tools via MCP server.
★ 3,628TypeScriptupdated 2026-04-16aiai-firstai-nativeeditorelectron
An AI Gateway, registry, and proxy that sits in front of any MCP, A2A, or REST/gRPC APIs, exposing a unified endpoint with centralized discovery, guardrails and management. Optimizes Agent & Tool calling, and supports plugins.
★ 3,616Pythonupdated 2026-04-20agentsaiapi-gatewayasyncioauthentication-middleware
Enterprise AI Platform with guardrails, MCP registry, gateway & orchestrator
★ 3,600TypeScriptupdated 2026-04-20a2aa2a-mcpacpagentai
⌥ AI Coding agent for the terminal — hash-anchored edits, optimized tool harness, LSP, Python, browser, subagents, and more
★ 3,508TypeScriptupdated 2026-04-18ai-agentai-coding-agentanthropicbunclaude
LangChain 🔌 MCP
★ 3,503Pythonupdated 2026-04-16langchainlanggraphmcppythontools
MCP server that interacts with Obsidian via the Obsidian rest API community plugin
★ 3,481Pythonupdated 2025-06-28
Semi-automated research assistant for academic research and software development. Supports Claude Code, OpenCode, and Codex CLI across ideation, coding, experiments, writing, and publication.
★ 3,447Pythonupdated 2026-04-15academic-researchai-agentsclaudeclaude-codecodex-cli
Chrome extension to let agents control your browser. Runs Playwright snippets in a stateful sandbox. Available as CLI or MCP
★ 3,415HTMLupdated 2026-04-16mcpplaywright
Allow LLMs to control a browser with Browserbase and Stagehand
★ 3,286TypeScriptupdated 2026-03-31aibrowserchromechromiummcp
162 production-ready AI agent templates for OpenClaw. SOUL.md configs across 19 categories. Submit yours!
★ 3,104HTMLupdated 2026-04-13ai-agent-templatesai-agentsai-automationanthropicautomation
Multi-modal Generative Media Skills for AI Agents (Claude Code, Cursor, Gemini CLI). High-quality image, video, and audio generation powered by muapi.ai.
★ 3,099Shellupdated 2026-04-13agent-toolsai-agentsai-artai-musicai-video
Catalog of official Microsoft MCP (Model Context Protocol) server implementations for AI-powered data access and tool integration
★ 3,046C#updated 2026-04-17
AI agent microservice
★ 3,034Pythonupdated 2026-03-14ag-ui-protocolagentaiassistantchatbot
n8n custom node for MCP
★ 3,007TypeScriptupdated 2026-01-02
AI conversations that actually remember. Never re-explain your project to your AI again. Join our Discord: https://discord.gg/tyvKNccgqN
★ 2,925Pythonupdated 2026-04-20aiclaudeknowledge-managementknowlege-graphllm
One command brings a complete pre-wired LLM stack with hundreds of services to explore.
★ 2,871TypeScriptupdated 2026-04-16aiautomationbashclicontainer
Connect Supabase to your AI assistants
★ 2,640TypeScriptupdated 2026-04-20
Postgres MCP Pro provides configurable read/write access and performance analysis for you and your AI agents.
★ 2,618Pythonupdated 2026-01-22
A Model Context Protocol server for converting almost anything to Markdown
★ 2,605TypeScriptupdated 2026-04-17aianthropicanthropic-aianthropic-claudemarkdown
Run MCP stdio servers over SSE and SSE over stdio. AI gateway.
★ 2,589TypeScriptupdated 2025-10-09
A metasearch library that aggregates results from diverse web search services
★ 2,557Pythonupdated 2026-04-20apiddgsdhtmcpmcp-server
The Unofficial and Awesome Home Assistant MCP Server
★ 2,555Pythonupdated 2026-04-20
Next Generation Agentic Proxy for AI Agents and MCP servers
★ 2,498Rustupdated 2026-04-17agentsaiai-gatewayapi-gatewaygateway-api
A bridge between Streamable HTTP and stdio MCP transports
★ 2,460Pythonupdated 2026-04-13mcpmcp-serverproxyssestreamable-http
Brings MCP to ChatGPT, DeepSeek, Perplexity, Grok, Gemini, Google AI Studio, OpenRouter, DeepSeek, T3 Chat and more...
★ 2,435TypeScriptupdated 2026-02-09aistudioassistantchatgptdeepseekgemini
extendable code review and QA agent 🚢
★ 2,351TypeScriptupdated 2025-11-24agentagentscicdcode-qualitycode-review
AI-assisted TradingView chart analysis — connect Claude Code to your TradingView Desktop for personal workflow automation
★ 2,335JavaScriptupdated 2026-04-04
Security scanner for AI agents, MCP servers and agent skills.
★ 2,253Pythonupdated 2026-04-23agentaimcpmodelcontextprotocolsecurity
MCP Aggregator, Orchestrator, Middleware, Gateway in one docker
★ 2,249TypeScriptupdated 2026-02-08mcpmcp-gatewaymcp-hostmcp-middlewaremcp-server
Comprehensive resources on Generative AI, including a detailed roadmap, projects, use cases, interview preparation, and coding preparation.
★ 2,239Jupyter Notebookupdated 2026-04-18agentic-aiagentic-frameworkclaudegeminigenai
Control Gmail, Google Calendar, Docs, Sheets, Slides, Chat, Forms, Tasks, Search & Drive with AI - Comprehensive Google Workspace / G Suite MCP Server & CLI Tool
★ 2,211Pythonupdated 2026-04-17aig-suitegmailgoogle-calendargoogle-chat
ChatMCP is an AI chat client implementing the Model Context Protocol (MCP).
★ 2,192Dartupdated 2025-09-15aichatclientmcpmcp-client
Terminal session manager for AI coding agents. One TUI for Claude, Gemini, OpenCode, Codex, and more.
★ 2,182Goupdated 2026-04-20ai-agentai-agentsai-coding-assistantaiderbubble-tea
Real-time crypto & stock screening, advanced technical indicators, Bollinger Bands intelligence, candlestick patterns + native Claude Desktop integration. Multi-exchange (Binance, KuCoin, Bybit+). Open-source AI trading infrastructure.
★ 2,173Pythonupdated 2026-04-14claude-desktopcryptocurrencymcp-servermcp-toolsopenclaw
PentestAgent is an AI agent framework for black-box security testing, supporting bug bounty, red-team, and penetration testing workflows.
★ 2,136Pythonupdated 2026-04-12aiai-agentsai-assistantai-cybersecurityai-hacking
🧩 MCP Gateway - A lightweight gateway service that instantly transforms existing MCP Servers and APIs into MCP servers with zero code changes. Features Docker deployment and management UI, requiring no infrastructure modifications.
★ 2,095TypeScriptupdated 2026-04-17awesomemcpmcp-adaptermcp-gatewaymcp-server
Shrimp Task Manager is a task tool built for AI Agents, emphasizing chain-of-thought, reflection, and style consistency. It converts natural language into structured dev tasks with dependency tracking and iterative refinement, enabling agent-like developer behavior in reasoning AI systems.
★ 2,088JavaScriptupdated 2025-08-21agentaicodeagentcoding-assistantcursor-ai
Completely free, private, UI based Tech Documentation MCP server. Designed for coders and software developers in mind. Easily integrate into Cursor, Windsurf, Cline, Roo Code, Claude Desktop App
★ 2,058TypeScriptupdated 2026-02-04clinecrawl4aicursordocumentationllm
Open Brain — The infrastructure layer for your thinking. One database, one AI gateway, one chat channel — any AI plugs in. No middleware, no SaaS.
★ 2,057TypeScriptupdated 2026-04-18ai-agentsmcpmemory-layermemory-layer-for-aiopen-brain
A unified hub for centrally managing and dynamically orchestrating multiple MCP servers/APIs into separate endpoints with flexible routing strategies
★ 2,034TypeScriptupdated 2026-04-19mcpmcp-gatewaymcp-hubmcp-routermcp-server
423 plugins, 2,849 skills, 177 agents for Claude Code. Open-source marketplace at tonsofskills.com with the ccpi CLI package manager.
★ 2,032Pythonupdated 2026-04-19agent-skillsaiai-agentsanthropicautomation
directory for Awesome MCP Servers
★ 1,997TypeScriptupdated 2025-03-26awesome-mcp-serversmcpmcp-server-storemcp-serversmcp-servers-directory
A Unified MCP Server Management App (MCP Manager).
★ 1,976TypeScriptupdated 2026-01-24llmllmopsmcpmcp-clientmcp-manager
Open-source credential vault, give your AI agents access to services without exposing keys.
★ 1,970TypeScriptupdated 2026-04-20ai-agentsclimcpnanoclawnodejs
★ 1,950Pythonupdated 2026-04-13
Witsy: desktop AI assistant / universal MCP client
★ 1,948TypeScriptupdated 2026-04-09anthropicdeepseekelectron-appelectronjsgemini
Allow all your Claude Codes to message each other ad-hoc!
★ 1,934TypeScriptupdated 2026-03-21
★ 1,929Pythonupdated 2026-04-16
Asynchronous coordination layer for AI coding agents: identities, inboxes, searchable threads, and advisory file leases over FastMCP + Git + SQLite
★ 1,896Pythonupdated 2026-04-20ai-agentscoordinationfastmcpmcppython
Development platform to debug, chat, inspect, and evaluate MCP servers, MCP apps, and ChatGPT apps.
★ 1,888TypeScriptupdated 2026-04-20anthropicchatgptcicddebuggerevals
AI as Workspace - An elegant AI chat client. Full-featured, lightweight. Support multiple workspaces, plugin system, cross-platform, local first + real-time cloud sync, Artifacts, MCP | 更好的 AI 客户端
★ 1,801TypeScriptupdated 2026-04-15aichatgptclaudecross-platformdocker
Dive is an open-source MCP Host Desktop Application that seamlessly integrates with any LLMs supporting function calling capabilities. ✨
★ 1,779TypeScriptupdated 2026-04-01aiai-agentsllm-interfacellm-uimcp-client
Semantic Intelligence for Large-Scale Engineering. Context+ is an MCP server designed for developers who demand 99% accuracy. By combining RAG, Tree-sitter AST, Spectral Clustering, and Obsidian-style linking, Context+ turns a massive codebase into a searchable, hierarchical feature graph.
★ 1,776TypeScriptupdated 2026-04-06mcp-server
Desktop AI Assistant powered by GPT-5, GPT-4, o1, o3, Gemini, Claude, Ollama, DeepSeek, Perplexity, Grok, Bielik, chat, vision, voice, RAG, image and video generation, agents, tools, MCP, plugins, speech synthesis and recognition, web search, memory, presets, assistants,and more. Linux, Windows, Mac
★ 1,749Pythonupdated 2026-02-06aiai-assistantartificial-intelligenceautonomous-agentchatbot
Open-source persistent memory for AI agent pipelines (LangGraph, CrewAI, AutoGen) and Claude. REST API + knowledge graph + autonomous consolidation.
★ 1,730Pythonupdated 2026-04-19agent-memoryagentic-aiai-agentsautogenclaude
★ 1,642TypeScriptupdated 2025-04-22
Coding assistant MCP for Claude Desktop
★ 1,613Pythonupdated 2025-12-25
MCP server that provides tools and resources for interacting with n8n API
★ 1,604TypeScriptupdated 2025-07-09
The Context Optimization Layer for LLM Applications
★ 1,593Pythonupdated 2026-04-26agentaianthropiccompressioncontext-engineering
An MCP server that installs other MCP servers for you
★ 1,521JavaScriptupdated 2024-11-26
Official MiniMax Model Context Protocol (MCP) server that enables interaction with powerful Text to Speech, image generation and video generation APIs.
★ 1,443Pythonupdated 2026-04-15image-generationimage-to-videomcpmcp-servermcp-tools
Make your own story. User-friendly software for LLM roleplaying
★ 1,420TypeScriptupdated 2026-04-18aicharacterschatchatbotclaude
Full computer-use for AI agents. Self-learning workflows. Native macOS. No screenshots required.
★ 1,410Swiftupdated 2026-03-23accessibilityai-agentsautomationclaude-codecomputer-use
An official Qdrant Model Context Protocol (MCP) server implementation
★ 1,366Pythonupdated 2026-03-31claudecursorllmmcpmcp-server
docker mcp CLI plugin / MCP Gateway
★ 1,365Goupdated 2026-04-15
The Terraform MCP Server provides seamless integration with Terraform ecosystem, enabling advanced automation and interaction capabilities for Infrastructure as Code (IaC) development.
★ 1,339Goupdated 2026-04-17
The Simple Agent Development Kit.
★ 1,319Pythonupdated 2025-08-23adkagent-based-modelingagent-development-kitagentsai
The python library for research and development in NLP, multimodal LLMs, Agents, ML, Knowledge Graphs, and more.
★ 1,311Pythonupdated 2026-04-20agentsaillmmcpmcp-client
Open-source CRM with native AI agent support. 30 MCP tools, REST API, self-hosted. Built with Laravel & Filament
★ 1,272PHPupdated 2026-04-20alpinecompanycontactscrmfilament
BrowserWing turns your browser actions into MCP commands Or Claude Skill, allowing AI agents to control browsers efficiently and reliably. Say goodbye to slow, token-heavy LLM interactions — let agents call commands directly for faster automation. Perfect for AI-driven tasks, browser automation, and boosting productivity.
★ 1,247Goupdated 2026-04-21aibrowsergolangllmreact
Claude Code as one-shot MCP server to have an agent in your agent.
★ 1,247JavaScriptupdated 2026-01-01agentclaudemcp
An MCP server that autonomously evaluates web applications.
★ 1,239Pythonupdated 2026-02-11debuggingdebugging-toolmcpmcp-servermodelcontextprotocol
Agent-MCP is a framework for creating multi-agent systems that enables coordinated, efficient AI collaboration through the Model Context Protocol (MCP). The system is designed for developers building AI applications that benefit from multiple specialized agents working in parallel on different aspects of a project.
★ 1,228TypeScriptupdated 2026-03-28
The Grafbase GraphQL Federation Gateway
★ 1,227Rustupdated 2026-04-19aiapienterprise-graphqlfederationgraphql
Connect AI models like Claude & GPT with robots using MCP and ROS.
★ 1,186Pythonupdated 2026-04-20mcpmcp-servermodelcontextprotocolrosros-mcp-server
🎙️ AI Dictation App - Open Source and Local-first ⚡ Type 3x faster, no keyboard needed. 🆓 Powered by open source models, works offline, fast and accurate.
★ 1,176TypeScriptupdated 2026-04-18aiai-note-taking-appasrdictatedictation
A single interface to use and evaluate different agent frameworks
★ 1,156Pythonupdated 2026-04-15a2aagent-evaluationagentsaimcp
AIPex: AI browser automation assistant, no migration and privacy first. Alternative to Manus Browser Operator、 Claude Chrome and Agent Browser
★ 1,154TypeScriptupdated 2026-04-13accessbility-testingagent-browseragent-skillsbrowser-automationbrowser-use
A web UI for Claude Code agents
★ 1,148TypeScriptupdated 2026-03-20agentaiclaudeclaude-codemcp
Natural (2-way) voice conversations with Claude Code
★ 1,125Pythonupdated 2026-04-19anthropicasrclaudeclaudecodekokoro
MCP integration for Google Calendar to manage events.
★ 1,101TypeScriptupdated 2026-03-30
A Model Context Protocol (MCP) server for Gmail integration in Claude Desktop with auto authentication support. This server enables AI assistants to manage Gmail through natural language interactions.
★ 1,097JavaScriptupdated 2025-08-06
Just a Better Chatbot. Powered by Agent & MCP & Workflows.
★ 1,076TypeScriptupdated 2026-03-23agentaiai-chatbotautomationchatbot
News Aggregation · AI Ratings · Trading Signals · Real-time Updates
★ 1,068Pythonupdated 2026-04-10
Search + Chat = SearChat(AI Chat with Search), Support OpenAI/Anthropic/VertexAI/Gemini, DeepResearch, SearXNG, Docker. AI对话式搜索引擎,支持DeepResearch, 支持OpenAI/Anthropic/VertexAI/Gemini接口、聚合搜索引擎SearXNG,支持Docker一键部署。
★ 1,043TypeScriptupdated 2026-04-16aianthropicdeepresearchgeminillm
MCP server for fetch web page content using Playwright headless browser.
★ 1,032TypeScriptupdated 2026-01-14aimcpplaywright
Calendar sync tool & universal calendar MCP server. Aggregate, sync and control calendars on Google, Outlook, Office 365, iCloud, CalDAV or ICS.
★ 1,028TypeScriptupdated 2026-04-10buncaldavcalendarcalendar-syncgoogle-calendar
Telegram MCP server powered by Telethon to let MCP clients read chats, manage groups, and send/modify messages, media, contacts, and settings.
★ 1,004Pythonupdated 2026-04-12adminapichat-managementcontactsgroups
Self-hosted MCP Gateway for Individuals & Teams
★ 980Goupdated 2026-04-20ai-agentsinfrastructuremcpmcp-gatewaymcp-registry
Claude Code for Finance
★ 950Pythonupdated 2026-04-20agentinvestmentlangchainlangraphllm
Neo4j Labs Model Context Protocol servers
★ 940Pythonupdated 2026-04-10databasemcpmcp-serverneo4jstdio
OpenAPI Tool Servers
★ 936Pythonupdated 2025-09-25aimcpopenapi
CLI MCP package manager & registry for all platforms and all clients. Search & configure MCP servers. Advanced Router & Profile features.
★ 933Pythonupdated 2026-03-27aiclaude-desktopcliclinecontinue
★ 926Pythonupdated 2026-02-11
ChatGPT CLI is a powerful, multi-provider command-line interface for working with modern LLMs. It supports OpenAI, Azure, Perplexity, LLaMA, and more, with features like streaming, interactive chat, prompt files, image/audio I/O, MCP tool calls, and an experimental agent mode for safe, multi-step automation.
★ 917Goupdated 2026-03-22agentagentic-aiazurechatgptcli
Labs to explore AI Models, MCP servers, and Agents with the AI Gateway powered by Azure API Management and Microsoft Foundry 🚀
★ 905Jupyter Notebookupdated 2026-04-17a2aagentsapimanagementautogenazure
A curated list of OpenClaw resources, tools, skills, tutorials & articles. OpenClaw (formerly Moltbot / Clawdbot) — open-source self-hosted AI agent for WhatsApp, Telegram, Discord & 50+ integrations.
★ 900updated 2026-04-14agentic-aiai-agentai-automationautonomous-agentsawesome
MCP server integration for DaVinci Resolve
★ 889Pythonupdated 2026-03-16blackmagicblackmagic-designblackmagicdesigndavinci-resolvedavinciresolve
Allow AI to wade through complex OpenAPIs using Simple Language
★ 889TypeScriptupdated 2026-02-21
★ 883TypeScriptupdated 2025-05-14
The best way to create, deploy, and share MCP Servers
★ 868Pythonupdated 2026-04-19aiai-gatewayarcadearcade-aillm-tool-call
Control Unreal Engine 5.5+ through AI with natural language. Build incredible 3D worlds and architectural masterpieces using MCP. Create entire towns, medieval castles, modern mansions, challenging mazes, and complex structures with AI-powered commands.
★ 852C++updated 2026-03-26
AgentKit: Build multi-agent networks in TypeScript with deterministic routing and rich tooling via MCP.
★ 846TypeScriptupdated 2026-04-08agentaiai-agent-frameworkai-agentsllm
Production-Ready MCP Server Framework • Build, deploy & scale secure AI agent infrastructure • Includes Auth, Observability, Debugger, Telemetry & Runtime • Run real-world MCPs powering AI Agents
★ 819Pythonupdated 2026-01-31agent-runtimeaiai-agentai-agent-toolsai-agents
Browse the web, directly from Cursor etc.
★ 819Pythonupdated 2025-07-10browserbrowser-usecursormcpmcp-server
Query MCP enables end-to-end management of Supabase via chat interface: read & write query executions, management API support, automatic migration versioning, access to logs and much more.
★ 818Pythonupdated 2025-09-26cursormodel-context-protocolsupabasewindsurf
A flexible multi-interface AI agent framework for building agents with reasoning, tool use, memory, deep research, blockchain interaction, MCP, and agents-as-a-service.
★ 801Pythonupdated 2026-04-07agentic-aiagentic-frameworkaimcp
This is the official repository for submitting MCP servers to be included in Cline's MCP Marketplace. If you’ve built an MCP server and want it to be discoverable and easily installable by millions of developers using Cline, submit your server here.
★ 766updated 2025-06-24
Connect ClickHouse to your AI assistants.
★ 761Pythonupdated 2026-04-17
A MCP server implementation for hyperbrowser
★ 759TypeScriptupdated 2025-11-20
An MCP server that provides control over Android devices via adb
★ 735Pythonupdated 2025-05-28
Complete MCP Platform -- Hosting, Registry, Gateway, and Chat Client
★ 726Goupdated 2026-04-17aichatmcpmodelcontextprotocol
MCP Server for SearXNG
★ 718TypeScriptupdated 2026-04-05aillmllm-agentmcpmcp-server
Awesome Claude Code plugins — a curated list of slash commands, subagents, MCP servers, and hooks for Claude Code
★ 711Pythonupdated 2025-10-14awesome-claude-codeawesome-listawesome-pluginsawesome-resourcesclaude-code
MCP server for Docker
★ 703Pythonupdated 2025-06-05
Install, manage and develop MCP servers and skills for agents
★ 694TypeScriptupdated 2026-04-16
A simple MCP server for Obsidian
★ 694TypeScriptupdated 2025-06-23
An MCP proxy server that aggregates and serves multiple MCP resource servers through a single HTTP server.
★ 681Goupdated 2026-02-19claudemcpmcp-clientmcp-servermodelcontextprotocol
A personal AI assistant for everyone
★ 680Pythonupdated 2026-04-13agentsartificial-general-intelligenceartificial-intelligenceautomationcontext
ARGO is an open-source AI Agent platform that brings Local Manus to your desktop. With one-click model downloads, seamless closed LLM integration, and offline-first RAG knowledge bases, ARGO becomes a DeepResearch powerhouse for autonomous thinking, task planning, and 100% of your data stays locally. Support Win/Mac/Docker.
★ 676Pythonupdated 2026-01-06agentagentic-aiaiaigcanthropic
A simple CLI to run LLM prompt and implement MCP client.
★ 672Pythonupdated 2025-12-02langchainllmmcpmodel-context-protocol
A text-based user interface (TUI) client for interacting with MCP servers using Ollama. Features include agent mode, multi-server, model switching, streaming responses, tool management, human-in-the-loop, thinking mode, model params config, MCP prompts, custom system prompt and saved preferences. Built for developers working with local LLMs.
★ 665Pythonupdated 2026-04-15agentic-aiaicommand-line-toolgenerative-ailinux
Official Jina AI Remote MCP Server
★ 655TypeScriptupdated 2026-03-14mcpmcp-server
★ 645Pythonupdated 2026-03-24
Claude Code LSP: enhance your Claude Code experience with non-IDE dependent LSP integration.
★ 620TypeScriptupdated 2026-02-22claudeclaude-codelspmcpmcp-server
A coding agent and general agent harness for building and orchestrating agentic applications.
★ 612TypeScriptupdated 2026-04-20aiai-agentai-agentsai-toolscontributions-welcome
a magical LLM desktop client that makes it easy for *anyone* to use LLMs and MCP
★ 611Svelteupdated 2025-10-20geminillmllm-clientllmslocal-llm
Enterprise-ready MCP Gateway & Registry that centralizes AI development tools with secure OAuth authentication, dynamic tool discovery, and unified access for both autonomous AI agents and AI coding assistants. Transform scattered MCP server chaos into governed, auditable tool access with Keycloak/Entra integration.
★ 608Pythonupdated 2026-04-19a2aagentic-aiagentsansdocumentdb
Convert Any OpenAPI V3 API to MCP Server
★ 603Goupdated 2025-04-03agentsmcpmcp-server
Daydreams is a set of tools for building agents for commerce
★ 603TypeScriptupdated 2026-03-018004agent-frameworkagent-frameworksagentsai
MCP Gateway is a reverse proxy and management layer for MCP servers, enabling scalable, session-aware stateful routing and lifecycle management of MCP servers in Kubernetes environments.
★ 599C#updated 2026-04-16aiapi-gatewayarm-deploymentsasp-net-coreazure
Fast, local-first web content extraction for LLMs. Scrape, crawl, extract structured data — all from Rust. CLI, REST API, and MCP server.
★ 597Rustupdated 2026-04-17aiai-agentsai-scrapingclicrawler
MCP Server for Metasploit
★ 590Pythonupdated 2026-02-05
MCP-Hub and -Inspector, Multi-Model Workflow and Chat Interface
★ 588TypeScriptupdated 2025-08-31
A MCP server for Home Assistant
★ 568TypeScriptupdated 2026-01-25
AI-based stock analysis and trading system
★ 558Pythonupdated 2026-04-15aillmmcpmulti-agentstock
A Model Context Protocol (MCP) server implementation that provides database capabilities for Chroma
★ 541Pythonupdated 2025-09-17
❤️ Generate mermaid diagram and chart with AI MCP dynamically.
★ 534TypeScriptupdated 2026-03-28mcpmcp-servermermaidmermaidjs
Home Assistant MCP server agent. Enable Claude Code, Cursor, VS Code or any MCP-enabled IDE to help you vibe-code and manage Home Assistant: create and debug automations, design dashboards, tweak themes, modify configs, and deploy changes using natural language
★ 528Pythonupdated 2026-04-18claudeclaudecodecopilot-enabledcursor-aihome-assistant
A personal context store for AI agents and assistants—reuse your existing coding agent CLI (Codex/Claude/OpenCode) with built‑in Skills/tools and a desktop GUI to capture, search, and reuse project knowledge across agents and repos.
★ 524JavaScriptupdated 2026-01-30agentaiai-agentsclaude-codecli
Universal MCP-Server for your Databases optimized for LLMs and AI-Agents.
★ 523Goupdated 2025-07-18amazon-bedrockanthropic-claudeapiautomatic-apiclickhouse
A Model-Context Protocol Server for YouTube
★ 515JavaScriptupdated 2025-03-20
Enable any LLM (e.g. Claude) to interactively debug any language for you via MCP and a VS Code Extension
★ 507TypeScriptupdated 2025-12-20anthropicautodebugautomationclaudecontext
The official MCP server to send emails and interact with Resend
★ 504TypeScriptupdated 2026-04-20
The only browser automation that bypasses anti-bot systems. AI writes network hooks, clones UIs pixel-perfect via simple chat.
★ 501Pythonupdated 2026-03-22ai-agent-toolsai-toolsanthropicanti-bot-bypassautomation-tools
A VSCode extension that lets you find and install Agent Skills and MCP Apps to use with GitHub Copilot, Claude Code, and Codex CLI.
★ 487TypeScriptupdated 2026-03-12agent-skillsclaude-code-skillsclaude-skillscodex-skillscopilot
MCP Server to interact with Google Gsuite prodcuts
★ 486Pythonupdated 2025-04-14
A centralized manager for Model Context Protocol (MCP) servers with dynamic server management and monitoring
★ 477JavaScriptupdated 2025-10-24aichatgptclaude-aillmslocal-development
A set of tools to connect to AI agents, to allow them to use Todoist on a user's behalf. Includes MCP support.
★ 463TypeScriptupdated 2026-04-20
🗂️🤖 Airtable Model Context Protocol Server, for allowing AI systems to interact with your Airtable bases
★ 440TypeScriptupdated 2026-04-11airtablemcp-servermodel-context-protocol
ZeroToken — Record once, automate forever. A lightweight MCP for agent-driven browser automation, script recording, and scheduled execution.
★ 436Pythonupdated 2026-03-12
Transform your Claude Code terminal with atomic precision statusline. Features flexible layouts, real-time cost tracking, MCP monitoring, prayer times, and beautiful themes.
★ 432Shellupdated 2026-04-19ai-toolsbashcachingclaude-codecli-tool
A CLI inspector for the Model Context Protocol
★ 430JavaScriptupdated 2025-08-13
Shinkai is a two click install App that allows you to create Local AI agents in 5 minutes or less using a simple UI. Supports: MCPs, Remote and Local AI, Crypto and Payments.
★ 427TypeScriptupdated 2026-02-03ai-agentscrypto-ai-agentsdecentralized-ailocal-ailocal-ai-agents
A unified Model Context Protocol server implementation that aggregates multiple MCP servers into one.
★ 423TypeScriptupdated 2026-04-19mcpmcp-clientmcp-gatewaymcp-proxymcp-server
TUI / CLI config manager for agentic harnesses (Amp, Claude Code, Opencode, Goose, Copilot CLI, Crush, Droid)
★ 418Rustupdated 2026-03-14aiampcodeclaude-codecliconfiguration
AI-Powered Revit Modeling
★ 398TypeScriptupdated 2026-02-25mcprevit
Enable AI agents to work reliably - giving them secure access to structured data, tools to take action, and the context needed to make smart decisions.
★ 396TypeScriptupdated 2026-04-20agentscopilotmcpmcp-servermonday
A Model Context Protocol (MCP) server that provides tools for fetching and analyzing Reddit content.
★ 395Pythonupdated 2025-05-11llmmcpmodel-context-protocolreddit
Local Groq Desktop chat app with MCP support
★ 390JavaScriptupdated 2026-02-14managed-by-terraform
MCP server for Todoist integration enabling natural language task management with Claude
★ 390JavaScriptupdated 2025-04-20
Context-Engine MCP - Agentic Context Compression Suite
★ 387Svelteupdated 2026-04-25aiai-agentscodexcompressioncontext
A centralized reverse-proxy platform for MCP servers — manage, group, and export as Skills from a single endpoint.
★ 386Goupdated 2026-03-18ai-agentmcpmcp-convert-to-skillmcp-managermcp-proxy
MCP Server to Use HuggingFace spaces, easy configuration and Claude Desktop mode.
★ 386TypeScriptupdated 2025-06-13
Bring Agent Skills to Any AI Agent and Coding Agent — via CLI or MCP. Manage once, serve anywhere.
★ 380Pythonupdated 2026-01-08agent-skillsai-agentclaudecodexcontext-engineering
Create a plan from a description in minutes
★ 374Pythonupdated 2026-04-19agiaillamaindexmcpollama
A collection of Model Context Protocol (MCP) servers, clients and developer tools by IBM.
★ 371updated 2026-04-17agentsllmmcpmodelcontextprotocoltoolcalling
The Official Model Context Protocol (MCP) server for Kagi search & other tools.
★ 370Pythonupdated 2026-04-08
A plugin-based gateway that orchestrates other MCPs and allows developers to build upon it enterprise-grade agents.
★ 367Pythonupdated 2026-01-22agentagent-securitygatewaygen-aigenai
RhinoMCP connects Rhino 3D to AI Agent through the Model Context Protocol (MCP)
★ 365Pythonupdated 2026-03-16
★ 354JavaScriptupdated 2026-01-03
🚀 Powerful Local AI Chat Application - Mcp, Secure, Efficient, Personalized 本地化部署的大模型客户端
★ 336JavaScriptupdated 2025-06-25deepseekmcpmcp-client
★ 322TypeScriptupdated 2026-01-28
An in-depth book and reference on building agentic systems like Claude Code
★ 309CSSupdated 2025-06-05agentagentic-aiaiclaudemcp
An MCP server for Massive.com Financial Market Data
★ 308Pythonupdated 2026-04-17cryptocurrencyfintechllmmarket-datamcp
mcp store manager, add & syncs MCP server configurations across clients like Claude code, Cursor💡mcphub
★ 308TypeScriptupdated 2026-04-17aiawesomeclaudedxtllm
A Model Context Protocol (MCP) server that helps read GitHub repository structure and important files.
★ 306Pythonupdated 2025-01-26gitllmmcpmodel-context-protocol
api router for MCP Servers
★ 305Goupdated 2025-07-22chatmcpmcpmcproutermcpservers
MCP implementation of Claude Code capabilities and more
★ 299Pythonupdated 2025-08-29claudeclaude-codemcpmcp-server
Discover Exceptional MCP Servers
★ 299TypeScriptupdated 2026-01-12mcp-servermodelcontextprotocol
The specification for the Universal Tool Calling Protocol
★ 297TypeScriptupdated 2026-04-23aiai-agent-toolsdocumentationmcpprotocol
An MCP Server for Chrome DevTools, following the Chrome DevTools Protocol. Integrates with Claude Desktop and Claude Code.
★ 297Pythonupdated 2025-10-06chromechromiumchromium-browserclaude-codeclaude-desktop
lightweight Python-based MCP (Model Context Protocol) server for local ComfyUI
★ 291Pythonupdated 2026-02-17comfyuicomfyui-apiimage-mcplocal-datalocal-mcp
Home Assistant MCP Server
★ 289Pythonupdated 2025-08-05home-assistanthome-automationmcpmcp-server
MCP server for browser automation using Playwright
★ 287JavaScriptupdated 2025-06-05
simple web ui to manage mcp (model context protocol) servers in the claude app
★ 286TypeScriptupdated 2026-02-07claudellmmcpmodel-context-protocolreact
MCP server that interacts with TickTick (Dida 365) via the TickTick Open API
★ 283Pythonupdated 2025-07-30
DeepContext is an MCP server that adds symbol-aware semantic search to Claude Code, Codex CLI, and other agents for faster, smarter context on large codebases.
★ 275TypeScriptupdated 2025-09-22aiai-agentsclaudeclaude-codecode
Model Context Protocol (MCP) Server for dify workflows
★ 275Pythonupdated 2025-04-20
Model Context Protocol (MCP) Server for reading from Google Drive and editing Google Sheets
★ 273TypeScriptupdated 2025-05-07
An introduction to the world of AI Agents
★ 268Jupyter Notebookupdated 2026-03-06agentagentic-aiagentsaiautogen
Fast, universal domain availability checker - 1,200+ TLDs, pattern generation, RDAP with WHOIS fallback. CLI + Rust library + MCP server for AI agents.
★ 267Rustupdated 2026-03-22asynccliconcurrencydomain-checkdomain-check-lib
A collection of MCP servers
★ 266updated 2025-03-30
Transform Claude Code into a complete development studio with 40+ specialized AI agents, MCP integrations, and enterprise-grade workflows
★ 265JavaScriptupdated 2025-08-12
Connect Claude Code and other AI tools to your Obsidian notes using Model Context Protocol (MCP)
★ 262TypeScriptupdated 2025-06-27
A powerful MCP server for Google search that enables parallel searching with multiple keywords simultaneously.
★ 260TypeScriptupdated 2025-06-14google-searchmcpplaywright
An MCP server implementation that provides tools for retrieving and processing documentation through vector search, enabling AI assistants to augment their responses with relevant documentation context.
★ 259TypeScriptupdated 2025-07-18llmmcpmcp-serversragvector-database
A TypeScript streamable HTTP and SSE proxy for MCP servers that use stdio transport.
★ 251TypeScriptupdated 2026-04-13
MCP for Proxmox integration in Cline
★ 249Pythonupdated 2025-02-19
Long-term memory layer for OpenClaw & MoltBook agents that learns and recalls your project context automatically.
★ 248TypeScriptupdated 2026-03-25aiclaudeclaude-codemcpmemory
A simple CLI chatbot that demonstrates the integration of the Model Context Protocol (MCP).
★ 248Pythonupdated 2024-12-05
★ 245JavaScriptupdated 2025-09-11
** THIS REPO HAS MOVED TO https://github.com/langchain-ai/langchainjs/tree/main/libs/langchain-mcp-adapters ** Adapters for integrating Model Context Protocol (MCP) tools with LangChain.js applications, supporting both stdio and SSE transports.
★ 245TypeScriptupdated 2025-05-16agent-toolsai-toolsjavascriptlangchainlangchainjs
Simplified Gemini for Claude Code.
★ 240Pythonupdated 2025-06-10claude-aigemini-flashmcpmcp-server
Lightweight MCP integration bringing Google's Gemini AI capabilities to Claude Code with 1M+ token context window, smart model selection, and powerful code analysis tools
★ 229Pythonupdated 2025-11-16claude-codeclaude-hooksgemini-apigemini-cli
🧬 Generate visual charts using ECharts with AI MCP dynamically, used for chart generation and data analysis.
★ 227TypeScriptupdated 2026-01-30echartsllmmcpmcp-server
Code search MCP for Claude Code. Make entire codebase the context for any coding agent. Embeddings are created and stored locally. No API cost.
★ 219Pythonupdated 2025-11-13agentai-codingclaudeclaude-codecode-generation
MCP server for AutoCAD LT v3.1: freehand AutoLISP execution, 8 consolidated tools, File IPC + ezdxf backends, focus-free dispatch, undo/redo, P&ID symbols, and robust IPC with ESC prefix and UTF-8 fallback. Companion agent skill: puran-water/autocad-drafting
★ 216Pythonupdated 2026-02-20
A curated list of OSINT MCP servers. Pull requests are welcomed!
★ 210updated 2026-04-19awesomeawesome-listawesome-listsmcpmcp-server
[DEPRECATED] Superseded by systempromptio/systemprompt-template and systempromptio/systemprompt-core. Multi-modal MCP client for voice-powered agentic workflows.
★ 210TypeScriptupdated 2025-02-03geminimcpmodel-context-protocolvoice-assistant
★ 209Pythonupdated 2025-03-25
K8s-mcp-server is a Model Context Protocol (MCP) server that enables AI assistants like Claude to securely execute Kubernetes commands. It provides a bridge between language models and essential Kubernetes CLI tools including kubectl, helm, istioctl, and argocd, allowing AI systems to assist with cluster management, troubleshooting, and deployments
★ 208Pythonupdated 2026-02-27ai-assistantargocdclaudedevopsdocker
Discover and compare open-source Agent Skills, tools & MCP servers — with quality scoring, trending analysis, and automated GitHub sync
★ 203TypeScriptupdated 2026-04-20
🍃🔎 MongoDB Lens: Full Featured MCP Server for MongoDB Databases
★ 201JavaScriptupdated 2025-04-23aiclaudedatabasellmmcp
An MCP proxy server that aggregates and serves multiple MCP resource servers through a single interface
★ 199TypeScriptupdated 2025-02-02
Discord MCP Server for Claude Integration
★ 198TypeScriptupdated 2025-01-21
A Model Context Protocol (MCP) server that enables AI assistants like Claude to interact with your Google Cloud Platform environment. This allows for natural language querying and management of your GCP resources during conversations.
★ 197TypeScriptupdated 2025-05-05
MCP server exposing multiple OSINT tools for AI assistants like Claude
★ 195Pythonupdated 2025-08-07aiclaudeholeheintelligence-gatheringinvestigation
This server acts as a central hub for Model Context Protocol (MCP) resource servers.
★ 192TypeScriptupdated 2025-07-27httpmcp-managementmcp-managermcp-proxymcp-proxy-server
Tool to work with arXiv, provide LLM with ability to search and read papers from there
★ 191Pythonupdated 2026-02-19
📓 An MCP server for managing your personal knowledge, daily notes, and re-usable prompts via GitHub Gists
★ 189TypeScriptupdated 2026-01-16gistsmcpmcp-servernotetakingpkm
Server-enforced workflow discipline for AI agents. An MCP server providing persistent work items, dependency graphs, quality gates, and actor attribution. Schemas define what agents must produce — the server blocks the call if they don't. Works with any MCP-compatible client.
★ 182Kotlinupdated 2026-04-16ai-coding-assistantai-developmentai-harnessai-memoryai-tools
A Nano Banana MCP server, which you can integrate to cursor/claude code and any mcp client
★ 182JavaScriptupdated 2025-11-04
MCP Server for Google Slides
★ 176TypeScriptupdated 2025-06-30
A YAML-based Playwright MCP automation testing framework designed for Claude Code
★ 176JavaScriptupdated 2025-07-19claudecodeplaywright
A Model Context Protocol (MCP) server that provides tools for fetching Reddit content, including frontpage posts, subreddit information and hot posts, post details, and comments.
★ 174Pythonupdated 2025-04-14
Turn a web server into an MCP server in one click without making any code changes.
★ 170Rustupdated 2026-03-11gatewaymcpmcp-serversproxy
MCP SSH Server: 37 tools for remote SSH management | Claude Code & OpenAI Codex | DevOps automation, backups, database operations, health monitoring
★ 168JavaScriptupdated 2026-04-09anthropicautomationbackupclaude-codedatabase
A desktop application that adds powerful tools to Claude and AI platforms
★ 166TypeScriptupdated 2025-02-19aiclaudemcpmodel-context-protocoltools
Model Context Protocol server that integrates AgentQL's data extraction capabilities.
★ 161Shellupdated 2026-04-14agentagentqlaiaiagentclaude
Model Context Protocol (MCP) Server for Langfuse Prompt Management. This server allows you to access and manage your Langfuse prompts through the Model Context Protocol.
★ 161TypeScriptupdated 2025-02-16langfusellmllmopsmcpmodel-context-protocol
Unopinionated AI for the Shell. A lightweight AI CLI for scripts, pipelines, and automation, with a universal client for MCP, A2A, and other AI protocols. .
★ 159TypeScriptupdated 2026-02-18
A connector for Claude Desktop to work with collection and sources on your Zotero Cloud.
★ 158TypeScriptupdated 2025-02-04
Python CLI for AI Chat with MCP support
★ 157Pythonupdated 2026-04-18
MCP Server MetaMCP manages all your other MCPs in one MCP.
★ 154TypeScriptupdated 2025-06-25
MCP Server connecting to Perplexity Comet browser
★ 152TypeScriptupdated 2026-01-13agentic-aiagentic-browserautomationmcp-server
Dynamically expose tools from proxied servers based on an Agent Persona
★ 152TypeScriptupdated 2025-10-21agentsclaude-codehypertoolhypertool-mcpllms
A Model Control Protocol (MCP) server that allows Claude to communicate with locally running LLM models via LM Studio.
★ 151Pythonupdated 2026-04-10
Connect any Open Data to any LLM with Model Context Protocol.
★ 150Pythonupdated 2024-12-20llmmcpopen-data
Declaratively define and run required tools across environments, from local development to containerized cloud deployments.
★ 149Goupdated 2026-04-07aiclidaemondeclarativemcp
A Model Context Protocol (MCP) server that provides authenticated access to Google Workspace APIs, offering integrated Authentication, Gmail, Calendar, and Drive functionality
★ 148TypeScriptupdated 2026-04-16aigoogle-workspacemcpmodel-context-protocol
Model Context Protocol server to allow for reading and writing from Pinecone. Rudimentary RAG
★ 148Pythonupdated 2025-01-31claudemcpmcp-servermodel-context-protocolpinecone
AI-powered browser automation MCP server for Claude Code. Navigate, click, screenshot, test — all from your terminal.
★ 146TypeScriptupdated 2026-04-16aiai-agentbrowser-automationclaudeclaude-code
🦞 MCP server for OpenClaw - secure bridge between Claude.ai and your self-hosted OpenClaw assistant with OAuth2 authentication
★ 146TypeScriptupdated 2026-03-31docker-composemcp-serveropen-clawproductivitysecurity
Typst MCP Server is an MCP (Model Context Protocol) implementation that helps AI models interact with Typst, a markup-based typesetting system. The server provides tools for converting between LaTeX and Typst, validating Typst syntax, and generating images from Typst code.
★ 144Pythonupdated 2026-04-18llmmcppandoctypst
This MCP or multiple AI setup let claude code use Grok, Gemini and DeepSeek for reviewing and fixes
★ 142Pythonupdated 2025-09-03
MCP server for Israel Government Data
★ 142Pythonupdated 2026-02-14
[DEPRECATED] Superseded by systempromptio/systemprompt-template and systempromptio/systemprompt-core. MCP server for orchestrating AI coding agents (Claude Code CLI & Gemini CLI).
★ 139TypeScriptupdated 2025-07-03aiclaude-codegemini-climcpmcp-server
LYRAI is a Model Context Protocol (MCP) operating system for multi-AI AGENTs designed to extend the functionality of AI applications by enabling them to interact with financial networks and blockchain public chains. The server offers a range of advanced AI assistants, including blockchain public chain operations (SOLANA,ETH,BSC,etc.)
★ 136Pythonupdated 2025-03-18
Token-efficient browser MCP server — structured web pages for AI agents, not raw accessibility dumps
★ 134TypeScriptupdated 2026-04-17ai-agentsmcpmcp-servermodel-context-protocoltypescript
Using ffmpeg command line to achieve an mcp server, can be very convenient, through the dialogue to achieve the local video search, tailoring, stitching, playback,clip, overlay, concat and other functions
★ 132Pythonupdated 2025-05-13
★ 129TypeScriptupdated 2025-11-24
A Google Tasks Model Context Protocol Server for Claude
★ 129TypeScriptupdated 2026-03-10
Model Context Protocol (MCP) server for the Webflow Data API.
★ 125TypeScriptupdated 2026-04-16built-with-fernbusiness-critical-yesgenerated-from-openapimcp-servermodel-context-protocol
Unify multiple MCP Servers & Skills into a single gateway — with proxy forwarding, authentication, and a management API. Typical use: expose local stdio servers as remote MCP endpoints, then use them in any web-based AI chat via a browser extension. 将多个 MCP Server 与 Skill 统一接入单一网关,提供转发、认证与管理 API。 典型用途:将本地 stdio 服务暴露为远程 MCP 端点,配合插件在网页 AI 聊天中直接调用。
★ 122Rustupdated 2026-03-30
【Star-crossed coders unite!⭐️】Model Context Protocol (MCP) server implementation providing Google News search capabilities via SerpAPI, with automatic news categorization and multi-language support.
★ 122TypeScriptupdated 2026-03-30aiclaudeclaude-desktopgoogle-news-apimcp
Letting Claude Code develop his own MCP tools :)
★ 121TypeScriptupdated 2025-03-08
Comprehensive MCP server providing real-time framework documentation access for Claude Code with intelligent caching, multi-source integration, and context-aware assistance.
★ 120TypeScriptupdated 2026-03-13ai-toolsasynccachingclaude-codedeveloper-tools
A list of MCP gateways
★ 118Pythonupdated 2026-04-03awesomeawesome-liste2bmcpmcp-gateway
MCP server for connecting agentic systems to search systems via searXNG
★ 117Pythonupdated 2025-02-21
Expose VSCode features such as file viewing and editing as MCP, enabling advanced AI-assisted coding directly from tools like Claude Desktop
★ 114TypeScriptupdated 2025-10-18
Enhanced Claude Code MCP server with orchestration capabilities, reliability improvements, and self-contained execution patterns
★ 111JavaScriptupdated 2025-05-20
A command-line tool for managing MCP servers in Claude App. Also can run a MCP Server to help you manage all your MCP Servers
★ 108TypeScriptupdated 2025-01-06claudeclimcpmodel-context-protocol
The coding agent for professionals
★ 108TypeScriptupdated 2025-08-18aianthropicclaudellmmcp
A Model Context Protocol (MCP) server that provides translation capabilities using the DeepL API.
★ 102JavaScriptupdated 2026-04-08
MCP OAuth Proxy incl. dynamic client registration (DCR), MCP prompt analytics and MCP firewall to build enterprise grade MCP servers.
★ 93Goupdated 2026-04-19agentsapi-gatewayauthentication-middlewaredevopsdex
💾 Model Context Protocol (MCP) server for Synology NAS - Enables AI assistants (Claude, Cursor, Continue) to manage files, downloads, and system operations through secure API integration. Features Docker deployment, auto-authentication, and comprehensive file system tools.
★ 92Pythonupdated 2026-04-01mcpmcp-serversynology
★ 91Pythonupdated 2024-12-25
TSGram - Telegram MCP Server for local Claude Code integration - debug and vibe code on the go!
★ 88JavaScriptupdated 2025-06-26
server that provides seamless integration with Tailscale's CLI commands and REST API, enabling automated network management and monitoring through a standardized interface
★ 87TypeScriptupdated 2026-02-03mcpmcp-serverstailscale
Enhanced MCP server for deep web research
★ 85TypeScriptupdated 2025-03-05
OpenAPI specification MCP server.
★ 85TypeScriptupdated 2025-03-30clinecursormcp-serveropenapiswagger
Open-source FRED MCP Server (Federal Reserve Economic Data)
★ 84TypeScriptupdated 2026-03-22datadata-analysis-projectfinancefinancial-analysisgenai
MCP Dockmaster allows you to easily install and manage MCP servers. Available for Mac, Windows and Linux as a Desktop App, CLI and a library.
★ 84Rustupdated 2025-06-05aicryptomcptools
MCP proxy server with lazy loading support - reduces context usage through on-demand tool activation
★ 84Goupdated 2026-01-09mcpmcp-server
CarrotAI is a cutting-edge AI agent application that delivers real-time streaming chat via Server-Sent Events (SSE) with built-in Model Control Protocol (MCP) integration. It supports concurrent connections to multiple SSE MCP servers and provides user interfaces in English, Chinese, and Japanese.
★ 83Dartupdated 2025-05-10
Microsoft Dataverse skills for AI coding agents. Wraps the Dataverse MCP server, Dataverse CLI, Python SDK, and PAC CLI behind specialist skills for building, querying, deploying, and administering Dataverse environments.
★ 80updated 2026-04-24agent-skillsdataversedynamics-365dynamics-crmmcp
List MCP Server configurations in your system used by AI applications like Cursor, Claude Desktop, VS Code and others
★ 80TypeScriptupdated 2026-04-10claude-aiclaude-desktopcursorcursor-aimcp
An MCP server that provides LLMs with efficient access to package documentation across multiple programming languages
★ 80TypeScriptupdated 2025-07-18aidocsdocumentationgojavascript
★ 79Pythonupdated 2025-12-09
The most accurate and comprehensive Context Engine as a service, optimized for large codebases, powered by advanced GraphRAG and accessible via MCP. It enriches the context for AI agents like Codex, Claude Code, Cursor, etc., making them 35% more efficient and up to 84% faster.
★ 78Pythonupdated 2026-04-17claude-codecursorgraphraglarge-codebasemcp
MCP server for Google News and Google Trends
★ 76Pythonupdated 2026-03-29
Build Awesome MCPs with Awesome Best Practices for MCP Servers and MCP Clients
★ 75updated 2025-08-16awesomeawesome-listllmmcpmcp-server
Real-time speech recognition & AI-powered note-taking app for macOS with offline/online modes, multilingual transcription, and Japanese translation support.
★ 75TypeScriptupdated 2026-02-03macosmcpmcp-clientopenaiscreenshot
Deprecated: Use the remote MCP server at https://mcp.sanity.io instead.
★ 73updated 2026-02-06cmsmcpmcp-server
Search, create and update Airtable bases, tables, fields, and records using Claude Desktop and MCP (Model Context Protocol) clients
★ 73JavaScriptupdated 2025-01-27
Claude Code extension manager — MCP servers, plugins (skills, hooks, agents), and marketplaces
★ 72TypeScriptupdated 2026-04-18anthropicclaudeclaude-codeclimarketplaces
An integration that allows LLMs to interact with Raindrop.io bookmarks using the Model Context Protocol (MCP).
★ 72TypeScriptupdated 2025-06-04modelcontextprotocolraindrop-io
An MCP server for Tavily's search API
★ 71Pythonupdated 2025-11-25mcpnewssearchtavilyweb
MCP Server with TMDB
★ 70JavaScriptupdated 2026-03-27
MCP Deep Research Server using Gemini creating a Research AI Agent
★ 70TypeScriptupdated 2025-08-12aiai-agentsai-researchai-research-assistantai-researcher
nocodb mcp server
★ 69JavaScriptupdated 2026-03-30mcpmcp-servernocodb
MCP server connecting Claude to Vercel
★ 67TypeScriptupdated 2025-08-05
Attio Model Context Protocol (MCP) server implementation
★ 67TypeScriptupdated 2026-04-16
A web-based GUI tool for managing Model Context Protocol (MCP) servers in Claude and Cursor
★ 66JavaScriptupdated 2024-12-17mcp
AI-native macro investment research infrastructure with native MCP, terminal CLI, agent runtime, and disciplined decision workflows. 一个 AI-native 的宏观投资研究基础设施,内建原生 MCP、Terminal CLI、Agent Runtime 与纪律化决策工作流。
★ 65Pythonupdated 2026-04-20ai-nativemacro-analysispersonal-agentpersonal-finance-agentresearch-infrastructure
Token-efficient data serialization for LLM/AI. 50% fewer tokens than JSON, 93% better value/token. Rust, schema validation, LSP.
★ 65Rustupdated 2026-04-20ai-mlclicsvdata-formatjson-alternative
Advanced MCP server for seamless access to Israeli Government Open Data
★ 64JavaScriptupdated 2025-08-31aiclaudedata-gov-ilgovernment-dataisrael
Universal MCP Server Configuration Manager
★ 62TypeScriptupdated 2026-01-22claudeclicursorgeminimcp
★ 61TypeScriptupdated 2025-02-24
MCP (Model Context Protocol) server for the Contentful Management API
★ 60TypeScriptupdated 2026-01-17
mcp-difyworkflow-server is an mcp server Tools application that implements the query and invocation of Dify workflows, supporting the on-demand operation of multiple custom Dify workflows.
★ 59Goupdated 2024-12-26aimcpmcp-server
★ 58TypeScriptupdated 2026-02-22
The official Pinecone marketplace for Claude Code Plugins
★ 57Pythonupdated 2026-03-06anthropic-claudeclaude-codeclaude-code-pluginclaude-code-plugin-marketplacehybrid-search
Thoughtbox is an intention ledger for agents. Evaluate AI's decisions against its decision-making.
★ 56TypeScriptupdated 2026-04-20ai-agentsclaudeclaude-codeclaudecodemcp
★ 55TypeScriptupdated 2024-12-02
An MCP server to communicated with, use, and wrap the API for the OpenAI Codex CLI tool.
★ 53Pythonupdated 2025-04-18
🎯 A unified personal data hub built on MCP that allows AI assistants to access your digital life from Steam, YouTube, Bilibili and more platforms for truly personalized interactions.
★ 52Pythonupdated 2026-03-24
An MCP Server for audio transcription using OpenAI
★ 52Pythonupdated 2025-10-16
TS based companion MCP server for the Drupal MCP module that works with the STDIO transport.
★ 50TypeScriptupdated 2025-05-01denodrupalmcpmcp-server
The brutally honest guide to 200+ AI agent platforms. Tier S-D ratings, x402 economy, 68+ CVEs, bug bounty pipeline. I registered on 200+ platforms so you don't have to.
★ 49Dockerfileupdated 2026-04-20agent-economyai-agentai-agentsaiagentawesome
Vapi MCP Server
★ 47TypeScriptupdated 2026-03-23aimcpmcp-servervapivoice-agents
Model Context Protocol server for Flight Tracking
★ 46JavaScriptupdated 2025-01-29
MCP Server for OPNSense to act as IaC proxy
★ 45TypeScriptupdated 2026-04-16
A Model Context Protocol (MCP) server that enables Claude Desktop to check domain availability across 50+ TLDs. Features DNS/WHOIS verification, bulk checking, and smart suggestions. Zero-clone installation via uvx.
★ 45Pythonupdated 2025-10-30ai-toolsanthropicclaudeclaude-aiclaude-desktop
A remote Model Context Protocol (MCP) server for interacting with the dev.to public API without requiring authentication.
★ 44TypeScriptupdated 2025-10-09mcpmcp-servermcp-serverstypescript
Simple MCP Manager Desktop Application
★ 44Pythonupdated 2025-08-26desktop-appmcppyqt6python3
MCP server for generating beautiful code screenshots directly from Claude
★ 44TypeScriptupdated 2025-11-06claude-codecodescreenshotmcpmcp-server
Multi-agent orchestration for Claude Code with 15-30% token optimization, self-improving agents, and automatic verification
★ 44TypeScriptupdated 2025-11-24ai-agentsai-poweredautomationclaude-codedatabase-integration
MCP server for Fal.ai - Generate images, videos, music and audio with Claude
★ 43Pythonupdated 2026-03-30ai-toolsclaudefal-aiimage-generationllm
Groq MCP server
★ 42Pythonupdated 2025-11-19managed-by-terraform
Netlify's Official MCP server
★ 41TypeScriptupdated 2026-03-09
A starting point for Claude Code to Codex collaboration
★ 39updated 2026-02-21
Token-efficient MCP server for tabular data retrieval. Index CSV/Excel files, query rows, aggregate — 99%+ token savings vs raw file reads.
★ 38Pythonupdated 2026-04-15
A package manager to manage all your mcp servers across platforms
★ 38JavaScriptupdated 2025-04-30cligithubmcpmodel-context-protocolnode
MCP server that gives Claude ability to use OpenAI's GPTs assistants
★ 37Pythonupdated 2025-09-12
A Model Context Protocol for checking domain name registration status in bulk.
★ 36Goupdated 2025-10-24golangmcp-server
Modular MCP server for OPNsense firewall management - 88 tools providing access to 2000+ methods through AI assistants
★ 36JavaScriptupdated 2025-07-06ai-assistantapiautomationclaudedevops
A currency conversion MCP server
★ 35TypeScriptupdated 2025-06-23
Telegram Bot MCP
★ 35Pythonupdated 2025-05-23
A task management MCP server that provides comprehensive project and task tracking capabilities
★ 35Pythonupdated 2025-04-16
AI-powered image generation using Google Gemini, integrated with Claude Code via Skills or Claude.ai via MCP (Model Context Protocol).
★ 34JavaScriptupdated 2026-03-15claudeclaude-codeclaude-extensionsclaude-pluginsclaude-skills
Fetch and read Jewish texts through the API of Sefaria.org
★ 33Pythonupdated 2025-06-17
This is a Model Context Protocol (MCP) server built with TypeScript. It provides a versatile tool to fetch and parse any standard RSS/Atom feed, and also includes special support for RSSHub feeds.
★ 31TypeScriptupdated 2025-12-12
LLM Gateway to call 100+ LLM APIs in OpenAI format with MCP supported.
★ 31Goupdated 2025-10-02
Get your projects MCP (Model Context Protocol) badges
★ 29updated 2025-01-03
A sophisticated Model Context Protocol (MCP) server for analyzing Architectural Decision Records (ADRs) and providing deep architectural insights to AI agents.
★ 28TypeScriptupdated 2026-04-20adrai-agentsarchitectural-decision-recordsarchitectureclaude
A collection of tools for your LLMs that run on Modal
★ 26Pythonupdated 2025-02-28
This an Model Context Protocol (MCP) server that integrates Notion into your AI workflows. This server enables seamless access to Notion through MCP, allowing AI agents to interact with pages, databases, and comments.
★ 26TypeScriptupdated 2025-02-18aimcpmcp-serversystemprompt
Claude Code tmux orchestration — spawn full AI sessions as parallel workers with heartbeat monitoring and file-based coordination
★ 25Shellupdated 2026-04-06ai-agentsautomationclaude-codedeveloper-toolsmcp
CLI tool for managing Model Context Protocol (MCP) servers in one place & using them across them different clients
★ 25Pythonupdated 2025-04-23artificial-intelligenceclimcpmcp-clientmcp-server
This is an MCP server that emulates Claude Code's task management system, providing persistent todo functionality for AI coding assistants in IDEs like Cursor, Windsurf, and others.
★ 25Pythonupdated 2025-11-21
★ 25TypeScriptupdated 2025-04-08
A comprehensive tool to manage Model Context Protocol (MCP) configurations for Claude code
★ 24Shellupdated 2025-06-14claude-aiclaude-codeclaude-mcpdevtoolsmcp
Multi-AI consensus MCP server that queries multiple AI models (OpenAI, Claude, Gemini, custom APIs) in parallel and synthesizes responses to reduce bias and improve accuracy. A Python implementation of the wisdom-of-crowds approach for AI decision making.
★ 23Pythonupdated 2025-06-26ai-consensusai-synthesisai-toolclaudeclaude-desktop
100+ tool MCP server for real-time global intelligence — markets, FX, bonds, earnings, SEC filings, conflict, military, cyber, climate, news, company enrichment, and 30+ domains. Live Leaflet dashboard with 20 map layers, SSE streaming, and AI situation briefs.
★ 23Pythonupdated 2026-04-06ai-toolsai-watchanthropicclaudecybersecurity
Open Source MCP gateway and proxy for Model Context Protocol (MCP) servers with enterprise authentication and service discovery
★ 22Pythonupdated 2025-09-03mcp-gatewaymcp-server
makes the jewish library accessible to LLMs through the MCP protocol
★ 22Pythonupdated 2025-04-17aijudaismllm
Stop AI coding disasters before they cost you weeks. Real-time anti-pattern detection for vibe coders who love AI tools but need a safety net to avoid expensive overengineering traps.
★ 21Pythonupdated 2025-12-02ai-codingai-safetyclaudeclaude-aiclaude-code
MCP server that enables AI agents to analyze projects, initialize vibe unified rules for AI coding across Claude Code, Cursor, GitHub Copilot, and Gemini CLI
★ 21TypeScriptupdated 2026-03-12
★ 20Rustupdated 2025-04-14
GitHub Repos Manager MCP Server that enables your MCP client (e.g., Claude Desktop, Roo Code, etc.) to interact with GitHub repositories using your GitHub personal access token.
★ 20JavaScriptupdated 2025-09-25
The LLM Council works together to answer your hardest questions
★ 18Pythonupdated 2026-03-12llm-agentsllm-as-a-judgellm-councilllm-toolsmcp
🐕 Universal MCP Server Manager - Configure once, manage multiple MCP servers through a single interface. Perfect for Claude Desktop, Claude Code, Cursor, Gemini CLI & AI assistants. Web dashboard, auto-detection, unified proxy layer.
★ 18TypeScriptupdated 2025-10-19ai-assistantclaudecursormcpmodel-context-protocol
★ 17TypeScriptupdated 2025-06-17
★ 17Pythonupdated 2025-04-30
WIP: A MCP server to search, install, uninstall all your MCP servers or services for your Claude App (or more)
★ 17TypeScriptupdated 2025-01-06
A Model Context Protocol (MCP) server that enables Claude Desktop to interact with Google's Gemini AI - featuring 7 tools with Smart Tool Intelligence that learns from your usage patterns
★ 17JavaScriptupdated 2025-12-02
★ 17TypeScriptupdated 2025-08-31aianthropicclaudedrugshealthcare
A high-performance speech recognition MCP server based on Faster Whisper, providing efficient audio transcription capabilities.
★ 17Pythonupdated 2025-03-22
FastMCP Server for Sefaria
★ 16Pythonupdated 2026-02-19
★ 15JavaScriptupdated 2025-03-07
A Model Context Protocol (MCP) server that provides programmatic access to Israeli Land Authority (רמ״י) public tender data.
★ 14Pythonupdated 2025-09-17
★ 14Pythonupdated 2025-04-14
Smart personal finance tracker for Israeli banks & cards. Features AI categorization, recurring payments, self-hosting (Docker), and MCP support.
★ 13TypeScriptupdated 2026-04-13aibudgetingdockerisraelmcp
A gateway service designed to manage and orchestrate OpenAI-compatible API servers with MCP support.
★ 13Rustupdated 2026-01-12gatewaymcpmcp-clientopenai
A high-performance Model Context Protocol (MCP) server providing local speech-to-text transcription using whisper.cpp, optimized for Apple Silicon.
★ 13TypeScriptupdated 2025-06-03appleapple-siliconm1m2m3
MCP Server for Windsurf
★ 13TypeScriptupdated 2025-03-06
1Password MCP server used for storing passwords create separate vault please
★ 12TypeScriptupdated 2026-03-161password1password-integrationmcp
A lightweight Model Context Protocol (MCP) server that provides persistent bookmark management for Claude and other MCP-compatible clients. Features categorized storage, resource discovery, and seamless integration with your AI workflow.
★ 12TypeScriptupdated 2025-09-13aibookmark-managerdockermcpmcp-server
A Claude Code research infrastructure that enforces citation compliance, validates scientific claims in real-time, and automatically structures your knowledge base.
★ 11Shellupdated 2025-10-21claude-codeliterature-reviewmcpobsidianpubmed
MCP server for creating UI flowcharts
★ 11TypeScriptupdated 2025-01-05
MCP server for Moltbook — the social network for AI agents
★ 10JavaScriptupdated 2026-04-20
A Personal Financial Data MCP Server over the israeli-bank-scrapers package
★ 10TypeScriptupdated 2025-11-20
MCP (Model Context Protocol) server for uploading media to Cloudinary using Claude Desktop
★ 10JavaScriptupdated 2025-03-13
a multi-modal MCP layer for real life — built on continuous video, semantic search and natural language video understanding.
★ 9Pythonupdated 2025-09-03
CLI tool to manage MCP servers in Claude Code
★ 9Pythonupdated 2025-09-11claude-aiclaude-codeclaude-desktopguigui-application
A MCP server that provides audio transcription capabilities using OpenAI's Whisper API
★ 9JavaScriptupdated 2025-03-25
mcp server of tavily
★ 9JavaScriptupdated 2025-02-24
Agent-native image-editing SDK for Claude Code. 21 MCP tools + /decompose skill — semantic layer splits, L1–L5 cultural scoring, region inpaint. Powered by ComfyUI, Gemini, or mock.
★ 8Pythonupdated 2026-04-26agent-nativeaianthropicartclaude-code
A Model Context Protocol (MCP) server that provides financial data access through automated Israeli bank and credit card data scraping. Supports all major Israeli financial institutions dynamically based on your configuration
★ 8TypeScriptupdated 2025-06-13
Codemagic CI/CD MCP Server
★ 8Pythonupdated 2025-05-01
The ultimate PyQt6 application that integrates the power of OpenAI, Google Gemini, Claude, and other open-source AI models
★ 7Pythonupdated 2025-12-07agentchatgptclaudedalleevaluator-optimizer-workflow
MCP server for Israel's RedAlert emergency alert system - real-time alerts, statistics, shelter search, and city data
★ 6TypeScriptupdated 2026-03-18
Production-ready MCP server for Donetick chores management with JWT authentication, Full API support, and 10 MCP tools
★ 6Pythonupdated 2025-11-18apichoresclaudedonetickmcp
MCP server for printing documents on macOS/Linux via CUPS
★ 6TypeScriptupdated 2026-02-14
Official MCP server for Smithery CLI
★ 6TypeScriptupdated 2025-04-13
Model Context Protocol extension for Hebrew calendar
★ 6TypeScriptupdated 2026-04-16
Deterministic video editing SDK for AI agents. Ships with MCP tools.
★ 5TypeScriptupdated 2026-03-15ai-agentclaudeeditingffmpegmcp
A Model Context Protocol (MCP) server for ZigBee2MQTT that provides intelligent device discovery and control for AI assistants
★ 5TypeScriptupdated 2025-10-19claude-aidockerhome-automationiotmcp
⚙️ A Model Context Protocol (MCP) server for accessing Amazon S3 buckets. This server provides seamless integration with S3 storage through MCP, allowing efficient handling of large files including PDFs through streaming capabilities.
★ 5TypeScriptupdated 2025-07-06
MCP server for homelab management - Docker, OPNsense, and TrueNAS integration
★ 4TypeScriptupdated 2026-01-07
🗣️ Whispers Talk. Recall. Repeat. A blazing-fast voice journal that remembers everything you say — searchable with AI. ✨ What is Whispers? Whispers is a voice-first journaling app powered by: 🧠 <300ms Latency Streaming Transcription (AssemblyAI) 🔍 Algolia MCP for instant search of your thoughts
★ 4TypeScriptupdated 2025-07-28
AI-powered music production in REAPER via the Model Context Protocol — 163 tools for composition, MIDI, FX, mixing, and mastering.
★ 3Pythonupdated 2026-04-17anthropicaudioclaudecompositiondaw
Unofficial MCP server for Make.com build, validate & deploy automation scenarios with AI. 200+ modules, auto-healing blueprints, router support. Community project, not affiliated with Make.com.
★ 3TypeScriptupdated 2026-04-06
Israel Fine Checker is an open-source skill and MCP server for checking Israeli parking and HOV/public-transport-route fines through `doh.co.il`, with Hebrew intake prompts and support for 63 municipalities.
★ 3JavaScriptupdated 2026-04-01
An MCP (Model Context Protocol) server for searching and browsing products on KSP.co.il — one of Israel's largest electronics and retail stores.
★ 3TypeScriptupdated 2026-03-28
Collection of MCP servers for Israeli data sources and APIs
★ 3TypeScriptupdated 2026-04-19
MCP for the National Library of Israel - AI-powered bridge for exploring millions of cultural, historical, and literary assets.
★ 3Pythonupdated 2025-08-26aiapiclaudeclaude-aiclaude-desktop
MCP server for querying Israeli real estate sales data by AI agents
★ 3Pythonupdated 2025-12-08
Israel Statistics MCP
★ 3TypeScriptupdated 2025-08-24
A powerful audio transcription server that seamlessly transcribes meeting recordings, generates notes, and intelligently splits audio files for efficient management. Open-source and built with FastMCP and Groq/OpenAI Whisper
★ 3Pythonupdated 2025-06-13
MCP server for real-time audio transcription using OpenAI Whisper
★ 3TypeScriptupdated 2025-10-08
Read-only AliExpress MCP server — search, product details, shipping estimates. Uses signed MTOP API calls (mtop.js replication) with cookies from mcp-auth-bridge.
★ 2Pythonupdated 2026-04-14
Israel law - Privacy Protection Law, Cyber Directorate regulations, Companies Law with HE/EN search
★ 2TypeScriptupdated 2026-04-16
A Model Context Protocol (MCP) server that demonstrates how to scrape financial data using the israeli-bank-scrapers library
★ 2JavaScriptupdated 2025-05-06
Real-time Israeli public transit MCP server with Google Routes, Places, GTFS, and Curlbus integration
★ 2Pythonupdated 2025-09-01
MCP Server for Israel budget
★ 2Pythonupdated 2025-04-29
MCP server providing access to Israeli Ministry of Health data dashboard APIs.
★ 2Pythonupdated 2025-05-15
A powerful MCP (Model Context Protocol) server that transcribes audio and video files into text using Groq's Whisper model.
★ 2Pythonupdated 2025-06-10
Production-ready Claude Code agents with checklists and MCP integrations.
★ 2Pythonupdated 2026-02-09
mcp server for homebox
★ 2Goupdated 2025-09-22
Agentic research assistant for Israeli Knesset data — LangGraph + RAG + MCP
★ 1Pythonupdated 2026-04-08
★ 1Pythonupdated 2026-04-11
Israel law - Privacy Protection Law, Cyber Directorate regulations, Companies Law with HE/EN search
★ 1updated 2026-04-08
Claude Pro Directory is a searchable collection of pre-built configurations, MCP servers, and custom rules designed to enhance Claude AI's performance for specific tasks.
★ 1updated 2025-12-19
A comprehensive MCP server for calculating Jewish prayer times (zmanim).
★ 1Pythonupdated 2025-10-31judaism
MCP server for getting information about disability permitted cars in Israel
★ 1updated 2025-06-26
Model Context Protocol (MCP) server for accessing the Israeli Knesset's parliamentary information API
★ 1TypeScriptupdated 2025-04-14
IMS (Israeli Meteorological Service) MCP Server
★ 1Pythonupdated 2026-02-04
Langflow-based LLM agent that keeps track of my personal projects. Based on integration with WhatsApp voice messages, Whisper, OpenAI/Mistral models and local MCP.
★ 1Pythonupdated 2025-06-22
A Model Context Protocol (MCP) server that provides ASR(Automatic Speech Recognition) capabilities using the whisper engine. This server exposes TTS functionality through MCP tools, making it easy to integrate speech synthesis into your applications.
★ 1Pythonupdated 2025-03-31
Whisper + TTS + As many MCP servers as I can stuff in
★ 1Pythonupdated 2025-05-01
Blazingly fast audio transcription MCP server using Whisper with Flash Attention 2
★ 1Pythonupdated 2025-12-04
mcp server for whisper-cli
★ 1Pythonupdated 2025-07-18
★ 1JavaScriptupdated 2025-08-05
Resumable Working Memory server for Codex/Claude CLI — an MCP backend that captures structured edits, decisions, and artifacts per project and serves compact “resume” bundles so coding agents can pick up exactly where they left off across sessions.
★ 1TypeScriptupdated 2025-10-02
AI-first deployment platform for Docker applications. Deploy via conversation with Claude Code using the Model Context Protocol (MCP).
★ 1Rustupdated 2025-10-10
An mcp for nuclino
★ 1TypeScriptupdated 2025-11-25
An MCP server to get Air Quality Data using AQICN.org
★ 1Pythonupdated 2025-02-04